Lus10014394 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G09925 101 / 9e-28 Pollen Ole e 1 allergen and extensin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023887 230 / 2e-78 AT3G09925 167 / 4e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G119100 115 / 5e-33 AT3G09925 180 / 7e-58 Pollen Ole e 1 allergen and extensin family protein (.1)
Potri.010G185400 43 / 2e-05 AT5G05500 166 / 8e-53 Pollen Ole e 1 allergen and extensin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0287 Transthyretin PF01190 Pollen_Ole_e_1 Pollen protein Ole e 1 like
Representative CDS sequence
>Lus10014394 pacid=23143713 polypeptide=Lus10014394 locus=Lus10014394.g ID=Lus10014394.BGIv1.0 annot-version=v1.0
ATGGCAACTGCTACTGGTTCATTGTTTGCAGCTACGACGGTCCTCGTCTTGCTCGCTGTGGCCGTGGCTCAGAAGGAGGAAGCTCCCACGGGAGAGCTTA
TTCACATCTCCGGTAAAGTCCTCTGTCAAGACTGCCAGAAGAGCTACTCCGATTGGGTCAACGGCGAAAGACCCCTCAAAGGCAGCAAGGTATCGCTGAC
GTGCATGGACGAGAGGAAGCGAGTGATGCACTACGACAGCGACGTGACGGACAGACAGAGGTCAGTACGAGATGGTGGCGGAAAATCTGGAGTAAAGCTC
GGCCAGCCCACATATGTCTCCCGTGGCTCGGCCACGTACGAGGTTGGATCGTTCTACTTCACGCACCCGAGGTGCGAGCGTCCTGAAGTTGGCACGTTTA
ACAAGGGCGAATCGGACGACGATCAGGAGTACTACCGTTACCCAGAGACCAAATACTGA
AA sequence
>Lus10014394 pacid=23143713 polypeptide=Lus10014394 locus=Lus10014394.g ID=Lus10014394.BGIv1.0 annot-version=v1.0
MATATGSLFAATTVLVLLAVAVAQKEEAPTGELIHISGKVLCQDCQKSYSDWVNGERPLKGSKVSLTCMDERKRVMHYDSDVTDRQRSVRDGGGKSGVKL
GQPTYVSRGSATYEVGSFYFTHPRCERPEVGTFNKGESDDDQEYYRYPETKY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G09925 Pollen Ole e 1 allergen and ex... Lus10014394 0 1
AT3G16520 UGT88A1 UDP-glucosyl transferase 88A1 ... Lus10039300 2.8 0.9032
AT2G45550 CYP76C4 "cytochrome P450, family 76, s... Lus10008918 14.3 0.8943
AT5G13430 Ubiquinol-cytochrome C reducta... Lus10035118 22.3 0.8799
AT3G06180 Ribosomal protein L34e superfa... Lus10004432 29.7 0.8596
AT5G67020 unknown protein Lus10019249 33.8 0.8507
AT5G08300 Succinyl-CoA ligase, alpha sub... Lus10010187 39.8 0.8521
AT5G03290 IDH-V isocitrate dehydrogenase V (.1... Lus10026519 42.8 0.8695
AT5G49610 F-box family protein (.1) Lus10000860 43.0 0.8625
AT1G30890 Integral membrane HRF1 family ... Lus10025577 45.6 0.8645
AT1G10630 ATARFA1F ADP-ribosylation factor A1F (.... Lus10001524 49.1 0.8678

Lus10014394 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.