Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G03460 60 / 7e-14 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023922 [exp] 114 / 2e-35 AT5G03460 81 / 8e-22 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G122600 [exp] 65 / 1e-15 AT5G03460 88 / 1e-24 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014419 pacid=23143718 polypeptide=Lus10014419 locus=Lus10014419.g ID=Lus10014419.BGIv1.0 annot-version=v1.0 ATGGGGAAAATCTATGCGATGTTCGGATGGGAGTACAGGAAGCCGGAGAGAGCTCCTCCTGCTTGCCCTTACAAGCCTGCCGCCAATAAGGATGATGGAA GCAAAGTTACGGCAGATAGCGAACTACCTATGGAACACCCACCAATCTCAAAATCTCTGGAAGCTGATAACAGGAAGGAAGACTAA
AA sequence Show only first row Show all	>Lus10014419 pacid=23143718 polypeptide=Lus10014419 locus=Lus10014419.g ID=Lus10014419.BGIv1.0 annot-version=v1.0 MGKIYAMFGWEYRKPERAPPACPYKPAANKDDGSKVTADSELPMEHPPISKSLEADNRKED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G03460			unknown protein		Lus10014419 [exp]	0	1
AT3G24315		ATSEC20	Sec20 family protein (.1)		Lus10023717 [exp]	1.0	0.9403
AT1G11910		ATAPA1, APA1	aspartic proteinase A1 (.1)		Lus10032636 [exp]	1.4	0.9215
AT1G77370			Glutaredoxin family protein (....		Lus10028355 [exp]	2.8	0.8990
AT1G15270			Translation machinery associat...		Lus10037543 [exp]	3.0	0.9178
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10022525 [exp]	3.9	0.8900
AT5G35080			unknown protein		Lus10039972 [exp]	4.6	0.8997
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10040625 [exp]	5.3	0.9089
AT3G20920			translocation protein-related ...		Lus10009945 [exp]	5.7	0.8942
AT2G29960		CYP19-4, ATCYP5...	CYCLOPHILIN 19-4, ARABIDOPSIS ...		Lus10018238 [exp]	5.8	0.8872
AT1G07080			Thioredoxin superfamily protei...		Lus10026384 [exp]	6.3	0.8847

Compare expression of checked genes

Lus10014419 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.