Plant FIBer expression Database

Lus10014426 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G36930 180 / 5e-59 C2H2ZnF zinc finger (C2H2 type) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023928
[exp]
241 / 2e-84 AT2G36930 182 / 1e-59 zinc finger (C2H2 type) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G124100
[exp]
188 / 2e-63 AT2G36930 184 / 1e-60 zinc finger (C2H2 type) family protein (.1)
Potri.016G093500
[exp]
187 / 7e-63 AT2G36930 184 / 2e-60 zinc finger (C2H2 type) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF12171 zf-C2H2_jaz Zinc-finger double-stranded RNA-binding
Representative CDS sequence
>Lus10014426 pacid=23143743 polypeptide=Lus10014426 locus=Lus10014426.g ID=Lus10014426.BGIv1.0 annot-version=v1.0
ATGGGAGGAAAATGCCCGAGTAGGAAGGTGAAGAAGAGAAGGTTCTCTCACAAGTCAGCTCGTCGCACCAAATTCGAACTCATGGGCGACGACGCGGTCT
ACGAACAATTGCAGAAGCCTGACGCCGATAAGAAACCGTTGCCCCTCGACGAGGACTTGCCTGGGATGGGCCAGTTTTACTGCTTGATCTGCGACCGCTA
CTTCGCTAATGTGGGTGTGAGAGATGAGCATTTCAAGACCAAGCGTCATAGGAAGCGTGTGAAGGAACTGAAAACTGCACCGCACACTCAACTCGATGCC
GACTTAGCAAGTGGTATGGGGATGCCAGACAATGGCCCTACGCTTATGTCGACGTGA
AA sequence
>Lus10014426 pacid=23143743 polypeptide=Lus10014426 locus=Lus10014426.g ID=Lus10014426.BGIv1.0 annot-version=v1.0
MGGKCPSRKVKKRRFSHKSARRTKFELMGDDAVYEQLQKPDADKKPLPLDEDLPGMGQFYCLICDRYFANVGVRDEHFKTKRHRKRVKELKTAPHTQLDA
DLASGMGMPDNGPTLMST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G36930 C2H2ZnF zinc finger (C2H2 type) family... Lus10014426
[exp]
0 1
AT5G09510 Ribosomal protein S19 family p... Lus10041168
[exp]
1.4 0.8942
AT4G26210 Mitochondrial ATP synthase sub... Lus10040553
[exp]
3.3 0.7746
AT5G64140 RPS28 ribosomal protein S28 (.1) Lus10013543
[exp]
4.5 0.8170
AT3G58030 RING/U-box superfamily protein... Lus10021063
[exp]
7.1 0.8327
AT5G15220 Ribosomal protein L27 family p... Lus10010822
[exp]
7.5 0.7430
AT3G18110 EMB1270 embryo defective 1270, Pentatr... Lus10013785
[exp]
7.7 0.7689
AT1G31817 NFD3 NUCLEAR FUSION DEFECTIVE 3, Ri... Lus10007591
[exp]
9.9 0.7858
AT2G39120 WTF9 what's this factor 9, Ubiquiti... Lus10037979
[exp]
11.9 0.7159
AT5G09500 Ribosomal protein S19 family p... Lus10021886
[exp]
12.1 0.8249
AT1G61700 RNA polymerases N / 8 kDa subu... Lus10025907
[exp]
12.6 0.7762

Lus10014426 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.