Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G02870 102 / 8e-28 Ribosomal protein L4/L1 family (.1.2) AT3G09630 100 / 8e-27 Ribosomal protein L4/L1 family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026476 [exp] 137 / 1e-40 AT3G09630 678 / 0.0 Ribosomal protein L4/L1 family (.1.2) Lus10019903 [exp] 128 / 2e-37 AT3G09630 674 / 0.0 Ribosomal protein L4/L1 family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G084400 [exp] 105 / 1e-28 AT3G09630 585 / 0.0 Ribosomal protein L4/L1 family (.1.2) Potri.006G132450 [exp] 103 / 5e-28 AT3G09630 617 / 0.0 Ribosomal protein L4/L1 family (.1.2) Potri.006G132551 [exp] 101 / 4e-27 AT3G09630 612 / 0.0 Ribosomal protein L4/L1 family (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014430 pacid=23143736 polypeptide=Lus10014430 locus=Lus10014430.g ID=Lus10014430.BGIv1.0 annot-version=v1.0 ATGGCCGCCACCGCCGCCGCTCGTCCCCTCGTCTCCGTCCAAACCCTCCCCGTCCTCAATGACATGGCCACCGATTCGCCAACCACCGTCCACCTCCCCG ACGTCATGCTATCCTCCATCCGCCCCGACGTCGTCAACTTCGTCCACGCCCAGATGTCAAACAACAGCCGCCAGCCCTACTCCGTCTCCAAGAAGTCAGG CCACCAGAACTTCTACGAGTAG
AA sequence Show only first row Show all	>Lus10014430 pacid=23143736 polypeptide=Lus10014430 locus=Lus10014430.g ID=Lus10014430.BGIv1.0 annot-version=v1.0 MAATAAARPLVSVQTLPVLNDMATDSPTTVHLPDVMLSSIRPDVVNFVHAQMSNNSRQPYSVSKKSGHQNFYE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G02870			Ribosomal protein L4/L1 family...		Lus10014430 [exp]	0	1
AT3G04770		RPSAB	40s ribosomal protein SA B (.1...		Lus10013183 [exp]	3.0	0.9720
AT3G54470			uridine 5'-monophosphate synth...		Lus10039539 [exp]	4.5	0.9672
AT5G44500			Small nuclear ribonucleoprotei...		Lus10003498 [exp]	4.9	0.9625
AT3G25150			Nuclear transport factor 2 (NT...		Lus10022765 [exp]	7.1	0.9499
AT3G04610		FLK	flowering locus KH domain, RNA...		Lus10006565 [exp]	7.5	0.9527
AT2G31610			Ribosomal protein S3 family pr...		Lus10012857 [exp]	9.6	0.9591
AT2G37270		ATRPS5B	ribosomal protein 5B (.1.2)		Lus10000946 [exp]	9.7	0.9588
AT5G44500			Small nuclear ribonucleoprotei...		Lus10013108 [exp]	10.4	0.9581
AT5G16390		CAC1-A, BCCP-1,...	BIOTIN CARBOXYL-CARRIER PROTEI...		Lus10004868 [exp]	10.5	0.9498
AT2G40510			Ribosomal protein S26e family ...		Lus10034223 [exp]	13.4	0.9515

Compare expression of checked genes

Lus10014430 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.