Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G09630 174 / 2e-54 Ribosomal protein L4/L1 family (.1.2) AT5G02870 168 / 6e-52 Ribosomal protein L4/L1 family (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014014 [exp] 234 / 9e-79 AT3G09630 510 / 0.0 Ribosomal protein L4/L1 family (.1.2) Lus10026476 [exp] 234 / 1e-77 AT3G09630 678 / 0.0 Ribosomal protein L4/L1 family (.1.2) Lus10019903 [exp] 231 / 2e-76 AT3G09630 674 / 0.0 Ribosomal protein L4/L1 family (.1.2) Lus10019904 [exp] 210 / 8e-69 AT3G09630 488 / 3e-173 Ribosomal protein L4/L1 family (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G132450 [exp] 186 / 6e-59 AT3G09630 617 / 0.0 Ribosomal protein L4/L1 family (.1.2) Potri.006G132551 [exp] 186 / 6e-59 AT3G09630 612 / 0.0 Ribosomal protein L4/L1 family (.1.2) Potri.016G084400 [exp] 164 / 2e-50 AT3G09630 585 / 0.0 Ribosomal protein L4/L1 family (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014431 pacid=23143711 polypeptide=Lus10014431 locus=Lus10014431.g ID=Lus10014431.BGIv1.0 annot-version=v1.0 ATGGTGAATGCTGACCTTGCTAGGATCATCAACTCCGATGAGGTTCAGTCTGTGGTGAAGCCCGTCAACAAGGAAGTTAAGAGGGCGACTCTGAAGAAGA ATCCCCTGAAGAACTTGAATGTGATGCTTAAGCTTAACCCCTATGCTAAGACTGCTAGGAGGATGTCCTTGTTGGCAGACGCCCAGCGCGTTAAGTCTAA GAAGGAGAAGCTGGACAGGAAGAGGACTCCAATCAGCAAGGAGGAAGCAAGTGCAATCAAGGCTGCAGGGAAGGCATGGTACAAAACAATGGAGTCGGAA AGCGACTACTCAGAGTTCGAGATCTTCTCCAAATGGCTGGGTGCTTCTCAGTAA
AA sequence Show only first row Show all	>Lus10014431 pacid=23143711 polypeptide=Lus10014431 locus=Lus10014431.g ID=Lus10014431.BGIv1.0 annot-version=v1.0 MVNADLARIINSDEVQSVVKPVNKEVKRATLKKNPLKNLNVMLKLNPYAKTARRMSLLADAQRVKSKKEKLDRKRTPISKEEASAIKAAGKAWYKTMESE SDYSEFEIFSKWLGASQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G09630			Ribosomal protein L4/L1 family...		Lus10014431 [exp]	0	1
AT2G04390			Ribosomal S17 family protein (...		Lus10004208 [exp]	1.4	0.9750
AT3G57610		ADSS, ATPURA	adenylosuccinate synthase (.1)		Lus10011317 [exp]	2.6	0.9515
AT5G27700			Ribosomal protein S21e (.1)		Lus10029895 [exp]	2.8	0.9580
AT4G34740		CIA1, ATASE2, A...	CHLOROPLAST IMPORT APPARATUS 1...		Lus10035459 [exp]	4.2	0.9423
AT1G03860		ATPHB2	prohibitin 2 (.1.2.3)		Lus10042515 [exp]	4.9	0.9611
AT3G53630			unknown protein		Lus10003983 [exp]	4.9	0.9463
AT2G04390			Ribosomal S17 family protein (...		Lus10029412 [exp]	5.7	0.9447
AT5G35530			Ribosomal protein S3 family pr...		Lus10030502 [exp]	6.2	0.9594
AT3G51010			unknown protein		Lus10042347 [exp]	6.6	0.9394
AT4G15770			RNA binding (.1)		Lus10037509 [exp]	7.2	0.9461

Compare expression of checked genes

Lus10014431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.