Lus10014459 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G13450 190 / 5e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT2G03720 80 / 1e-18 MRH6 morphogenesis of root hair 6, Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT3G03290 76 / 3e-16 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT5G17390 72 / 4e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
AT1G69080 70 / 2e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
AT1G44760 69 / 3e-14 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032598 328 / 4e-115 AT4G13450 177 / 7e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10043152 323 / 4e-113 AT4G13450 178 / 4e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10023716 253 / 5e-87 AT4G13450 136 / 2e-41 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10019173 81 / 1e-18 AT1G69080 192 / 2e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Lus10034661 66 / 7e-13 AT5G17390 160 / 3e-48 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10007982 63 / 1e-11 AT5G17390 149 / 1e-43 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10025644 57 / 6e-10 AT1G44760 211 / 1e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10029664 54 / 1e-08 AT1G44760 236 / 2e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Lus10042701 52 / 3e-08 AT1G44760 235 / 6e-79 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G064800 216 / 2e-71 AT4G13450 194 / 4e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.008G109000 90 / 9e-22 AT1G69080 196 / 6e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.T170801 89 / 3e-21 AT1G69080 196 / 3e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.010G140200 87 / 6e-21 AT1G69080 202 / 3e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2)
Potri.015G060700 82 / 4e-19 AT3G03290 198 / 2e-63 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.002G084600 61 / 4e-11 AT1G44760 200 / 5e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Potri.005G177100 54 / 1e-08 AT1G44760 226 / 3e-75 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0039 HUP PF00582 Usp Universal stress protein family
Representative CDS sequence
>Lus10014459 pacid=23176860 polypeptide=Lus10014459 locus=Lus10014459.g ID=Lus10014459.BGIv1.0 annot-version=v1.0
ATGGGAAGCGACACAGCGATGAGGAAAGTTATGGTGGTTGTTGACCCCAGCAGGGAAGCTGCAGGGGCTCTTCAGTACGCTCTTTCTCACGTCGTCACCG
AGAAAGACGAGCTCATCTTGGTCCATGTCGAGACCCAGAACTCATGGAAGAACACCTTCTCGTTTTCCTTCCTCCCCCGCTCCGGCATCTCCATCCCTGC
CCTCAACAATAGCAATGGCAATAACAACAGCAGCAACAACAATAATAATAATAATTACCAGTCATCAGCAGCAACGGGAGCTGATGGAATGGCAGAAGGG
GAGGTTGATTTCTTGGAAGCAATGAAGCAGCTTTGCGAGGTGGCGAGGCCTAGGGTGAGGGTGAAGGTTGAGAGGGTTCAGATGGGAGCTAAAGACAAGG
CAAGTGTCATCCTTTTCAAGAGCACCTCCATGGCTGTTGATCATCTCATCATTGGCCAGAAGAAGAGCCTCTCCAGCGTCTTGTTAGGGAACACCAAATA
CAAGAAACCAGGAGGGTTAGGGCCAAAGTCGTTGGACACTGCAGAGTATTTGATCGAGTACAGCAAGTGCAATTGTGTCGGAGTCCAGAAAAAGGGGCAA
ACTGGAGGTTATCTACTCAATACCAAGACCCAGAAGAATTTCTGGCTTCTCGCTTAA
AA sequence
>Lus10014459 pacid=23176860 polypeptide=Lus10014459 locus=Lus10014459.g ID=Lus10014459.BGIv1.0 annot-version=v1.0
MGSDTAMRKVMVVVDPSREAAGALQYALSHVVTEKDELILVHVETQNSWKNTFSFSFLPRSGISIPALNNSNGNNNSSNNNNNNNYQSSAATGADGMAEG
EVDFLEAMKQLCEVARPRVRVKVERVQMGAKDKASVILFKSTSMAVDHLIIGQKKSLSSVLLGNTKYKKPGGLGPKSLDTAEYLIEYSKCNCVGVQKKGQ
TGGYLLNTKTQKNFWLLA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G13450 Adenine nucleotide alpha hydro... Lus10014459 0 1
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10041851 1.4 0.9182
AT1G59710 Protein of unknown function (D... Lus10030804 3.2 0.9000
AT2G38290 AMT2;1, ATAMT2 AMMONIUM TRANSPORTER 2;1, ammo... Lus10028397 5.2 0.8774
AT1G74830 Protein of unknown function, D... Lus10033123 6.5 0.8546
Lus10029449 6.5 0.8587
AT2G34930 disease resistance family prot... Lus10029483 6.6 0.8359
AT4G13450 Adenine nucleotide alpha hydro... Lus10023716 6.9 0.8687
AT2G22560 Kinase interacting (KIP1-like)... Lus10012730 7.2 0.8315
AT3G07040 RPS3, RPM1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10028639 8.0 0.8494
AT3G45640 ATMAPK3, ATMPK3 mitogen-activated protein kina... Lus10018127 8.9 0.8628

Lus10014459 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.