Lus10014469 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43960 156 / 4e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT5G60980 144 / 2e-38 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT5G48650 106 / 6e-25 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT3G25150 94 / 7e-21 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT3G07250 90 / 6e-19 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1)
AT1G13730 83 / 4e-17 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
AT2G03640 82 / 7e-17 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
AT1G69250 59 / 2e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
AT3G55540 44 / 0.0002 nuclear transport factor 2 (NTF2) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10023722 533 / 0 AT5G43960 266 / 2e-83 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10022873 184 / 2e-53 AT5G43960 377 / 1e-127 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10003144 134 / 1e-34 AT3G25150 385 / 2e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10036918 123 / 1e-30 AT2G03640 250 / 4e-78 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10025906 123 / 3e-30 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10037066 118 / 6e-29 AT2G03640 248 / 2e-77 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Lus10024953 107 / 4e-27 AT5G43960 159 / 8e-47 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10022765 103 / 6e-24 AT3G25150 408 / 1e-138 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Lus10026668 93 / 3e-20 AT2G03640 255 / 5e-80 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G065500 250 / 2e-78 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.002G257000 186 / 6e-54 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.014G192900 171 / 2e-48 AT5G43960 392 / 3e-133 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.015G058700 110 / 3e-26 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.002G246600 104 / 4e-24 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.017G094600 99 / 1e-22 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2)
Potri.008G096700 99 / 2e-22 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain
Potri.010G157800 95 / 5e-21 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1)
Potri.003G170800 42 / 9e-05 AT1G27970 230 / 1e-79 nuclear transport factor 2B (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0221 RRM PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
CL0051 NTF2 PF02136 NTF2 Nuclear transport factor 2 (NTF2) domain
Representative CDS sequence
>Lus10014469 pacid=23176855 polypeptide=Lus10014469 locus=Lus10014469.g ID=Lus10014469.BGIv1.0 annot-version=v1.0
ATGGCTTCTCCTTATGCTATGCCGGTTACTGCTGCTCAGGTGGACAACCAATCTTTCCTTCGTGGTTCTGCGGGTACCGCTGTAGGGACGTATTTTGTGA
GACAATACTATGAAGTGCTGCAGTCTCAACCGGCCCTTGTCCACCAGTTCTATAGTGATTTCAGCACCATGCTTCGCATTGATGGCTCTACTCGAGAATC
CTACACCACGATACTTGATATCCATTCACTCATCATGTGCCTCAACTACACCGCGATTGAAATCAAGACGGCACATGCCTTGGAATCATGGAACTGTGGG
GTTCTTGTGATGGTGTCTGGTCATTTGCGGTCGATGAACTTTGGTGGAACCAAGAAGTTTGTTGAGACTTTTTTCTTAGCACCCCAAGACAAAGGGTATT
TTGTTCTCAACGACGTGTTCCACTTCATTGAAGAGGAACAACTTCACCACCATCCGGGTGTATTGTTAGCACAAAGGAATCATGATTCCAATCTTAATGC
TCATTCTACCACTATTTCTGAACCAGTGTCAAATTATTTGTTCGATGGAGAAAGTCAGTCGAAGGAGTTCCTAGCTCCTACTGATACTGTGGAACTTTTA
CGGGTTGCTAAGGAGCAACCTGCACCTCCAGCAACATCAGAACGGAACCACAACTCTCCAGCTACTTCTCAAACGACGATTGTGACATCAAATTCCGTTG
ATAACTACACTACTGACAATGTAGATGAGCCTTTAGGTGCAGAAGATGAAGATGAAATAAGATCCGTATACGTTAGGAACTTGGCACCTACTGCCTCTGA
AGAAGAGATTGAGGAGGAATTCACCAAGTTTGGGAAAGTAGCACCTGAAGGTGTTGTCATTAGGAGTCGCCAGGACGTTGGTGTATGTTATGCATTTGTT
GAATTCGAAGACATGAATGGTGTTCTCAATGCTGTGAAAGCGGGCAGTGCACAGGTTGCCGGCAGGCCAGTATACATTGAGGAACGGAGACCAAACAGTT
ACATTCCATCTCGATTTGGAAGGGGGAGAGGCAGGGGAAGGGGCAGCTACTACCAAGCAGACGCTACTCGTGGTCGTTTTGGTTCACGAAGTTTCGGTAG
GGGCGGCAGCTACGACGGGGAGTACAACAGAGGCAGAGGAAATGGATATTACAGGCCAATTAATCGCCAAGACATGGCATCAATGGAGAGTGGACAAAAT
GAGTCCGACTATACATCTTAG
AA sequence
>Lus10014469 pacid=23176855 polypeptide=Lus10014469 locus=Lus10014469.g ID=Lus10014469.BGIv1.0 annot-version=v1.0
MASPYAMPVTAAQVDNQSFLRGSAGTAVGTYFVRQYYEVLQSQPALVHQFYSDFSTMLRIDGSTRESYTTILDIHSLIMCLNYTAIEIKTAHALESWNCG
VLVMVSGHLRSMNFGGTKKFVETFFLAPQDKGYFVLNDVFHFIEEEQLHHHPGVLLAQRNHDSNLNAHSTTISEPVSNYLFDGESQSKEFLAPTDTVELL
RVAKEQPAPPATSERNHNSPATSQTTIVTSNSVDNYTTDNVDEPLGAEDEDEIRSVYVRNLAPTASEEEIEEEFTKFGKVAPEGVVIRSRQDVGVCYAFV
EFEDMNGVLNAVKAGSAQVAGRPVYIEERRPNSYIPSRFGRGRGRGRGSYYQADATRGRFGSRSFGRGGSYDGEYNRGRGNGYYRPINRQDMASMESGQN
ESDYTS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43960 Nuclear transport factor 2 (NT... Lus10014469 0 1
AT4G24810 Protein kinase superfamily pro... Lus10043122 2.8 0.9160
AT5G43960 Nuclear transport factor 2 (NT... Lus10023722 4.7 0.9192
AT4G38020 tRNA/rRNA methyltransferase (S... Lus10035953 7.2 0.9086
AT2G44640 unknown protein Lus10043347 8.7 0.8987
AT1G19920 ASA1, APS2 ATP SULFURYLASE ARABIDOPSIS 1,... Lus10033158 8.9 0.8819
AT3G05510 Phospholipid/glycerol acyltran... Lus10029891 9.9 0.9093
AT4G17040 HON5, CLPR4 happy on norflurazon 5, CLP pr... Lus10011014 11.2 0.8867
AT4G33680 AGD2 ABERRANT GROWTH AND DEATH 2, P... Lus10010748 12.4 0.8621
AT3G52170 DNA binding (.1.2) Lus10017453 14.4 0.8591
AT1G48570 zinc finger (Ran-binding) fami... Lus10009049 15.8 0.8610

Lus10014469 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.