Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73840 40 / 5e-05 ESP1 ENHANCED SILENCING PHENOTYPE 1, hydroxyproline-rich glycoprotein family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009030 [exp] 71 / 9e-16 AT1G73840 197 / 2e-59 ENHANCED SILENCING PHENOTYPE 1, hydroxyproline-rich glycoprotein family protein (.1) Lus10009670 [exp] 66 / 4e-14 AT1G71800 192 / 7e-58 cleavage stimulating factor 64 (.1) Lus10033878 [exp] 47 / 3e-07 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G056200 [exp] 41 / 2e-05 AT1G73840 224 / 2e-69 ENHANCED SILENCING PHENOTYPE 1, hydroxyproline-rich glycoprotein family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014474 pacid=23176864 polypeptide=Lus10014474 locus=Lus10014474.g ID=Lus10014474.BGIv1.0 annot-version=v1.0 ATGGCGGGAAAGCCGGACCCCGCCGACGTCCTGGCGGCGGACTTCGTCGGGATGACAAAGAGTCAGCTCTATGATATCATGTCTCAGATGAAGGCAAGTC CCCCATTCATCCTTTTCTCTTGCTTTCTCCTCTCTTCTCTTCTTTTCTCTTCTCTCATCTTTCTCCCAGTCTCGAACAATACCGCGGGTAAAAGACGGCC ACAAGTTTATTTCTTGCACGCCCGAGCAACAGATGCATACGATCTAATTGAGTTACGAAAAGGGTAA
AA sequence Show only first row Show all	>Lus10014474 pacid=23176864 polypeptide=Lus10014474 locus=Lus10014474.g ID=Lus10014474.BGIv1.0 annot-version=v1.0 MAGKPDPADVLAADFVGMTKSQLYDIMSQMKASPPFILFSCFLLSSLLFSSLIFLPVSNNTAGKRRPQVYFLHARATDAYDLIELRKG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014474 [exp]	0	1
					Lus10024757 [exp]	1.4	0.9692
AT1G12064			unknown protein		Lus10039031 [exp]	2.6	0.8943
AT2G25700		ASK3	SKP1-like 3 (.1)		Lus10043288 [exp]	3.5	0.9525
AT2G03630			unknown protein		Lus10029645 [exp]	3.5	0.9539
AT3G15650			alpha/beta-Hydrolases superfam...		Lus10002034 [exp]	3.9	0.8607
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Lus10012572 [exp]	4.0	0.8404
					Lus10034143 [exp]	4.2	0.9539
AT3G26790	B3	FUS3	FUSCA 3, AP2/B3-like transcrip...		Lus10012573 [exp]	5.9	0.9430
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10021709 [exp]	6.9	0.8935
					Lus10033498 [exp]	6.9	0.7969

Compare expression of checked genes

Lus10014474 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.