Lus10014480 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G80160 243 / 2e-83 GLYI7 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT1G15380 227 / 6e-77 GLYI4 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
AT2G28420 174 / 8e-56 GLYI8 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT5G57040 54 / 3e-09 Lactoylglutathione lyase / glyoxalase I family protein (.1)
AT2G32090 52 / 7e-09 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030070 337 / 2e-120 AT1G80160 247 / 7e-85 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10005324 169 / 1e-53 AT2G28420 245 / 2e-83 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10039579 168 / 4e-53 AT2G28420 248 / 2e-84 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10014269 159 / 9e-50 AT1G15380 166 / 2e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10025971 159 / 1e-49 AT1G15380 165 / 3e-52 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10017158 53 / 8e-09 AT5G57040 254 / 7e-87 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Lus10006122 47 / 9e-07 AT2G32090 199 / 3e-67 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10010552 45 / 5e-06 AT2G32090 197 / 3e-66 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Lus10021573 43 / 2e-05 AT5G57040 163 / 2e-51 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G129200 248 / 3e-85 AT1G80160 225 / 1e-76 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.001G171600 241 / 1e-82 AT1G80160 270 / 6e-94 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G062400 240 / 4e-82 AT1G80160 261 / 2e-90 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.003G009000 184 / 1e-59 AT1G80160 190 / 8e-62 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.004G223300 182 / 1e-58 AT1G80160 187 / 1e-60 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.007G015100 178 / 3e-57 AT1G15380 167 / 7e-53 glyoxylase I 4, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.005G117000 172 / 4e-55 AT1G80160 166 / 2e-52 glyoxylase I 7, Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
Potri.009G055500 164 / 9e-52 AT2G28420 229 / 1e-77 glyoxylase I 8, Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.018G056200 49 / 3e-07 AT5G57040 253 / 2e-86 Lactoylglutathione lyase / glyoxalase I family protein (.1)
Potri.010G087000 47 / 6e-07 AT2G32090 189 / 3e-63 Lactoylglutathione lyase / glyoxalase I family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0104 Glyoxalase PF00903 Glyoxalase Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily
Representative CDS sequence
>Lus10014480 pacid=23176833 polypeptide=Lus10014480 locus=Lus10014480.g ID=Lus10014480.BGIv1.0 annot-version=v1.0
ATGGTGATGGGAATTGAAAGCCCACTGCAGCTGAAGTCATTGAATCACATATCCCTCGTCTGTCGATCCGTTGAGAAATCCCTGGAATTCTACCAGCACG
TTCTTGGTTTCTTCCCCATCCGCCGCCCTGGCTCCTTCGACTTCGATGGCGCCTGGCTGTTCGGTTACGGAATCGGAATCCATTTGCTTCAGTCAGAGGA
CCCAGAGAGCATGCCCAAAATCTGCGTCATCAACCCAAAAGACAACCACATCTCCTTCCAATGTGAGAGCATGGCGACGGTGGAGAAGAAGCTAAAGGAG
ATGGAGATCGAGTACGTGAAAGGGAGAGTGGAGGAAGGAGGAATCTACGTGGATCAGCTATTCTTCCACGACCCAGATGGTTCCATGATTGAAATATGCA
ATTGCGACAATCTCCCAGTCGTCCCTCTCTCTGGAGAAGCTATTCGTTCTTGCTCTCTCATAAACTGCACCATCCAGCAGCAGCAGCAGCAGAAGGAGCT
CTTGAACCAGCTCTGCAAATGA
AA sequence
>Lus10014480 pacid=23176833 polypeptide=Lus10014480 locus=Lus10014480.g ID=Lus10014480.BGIv1.0 annot-version=v1.0
MVMGIESPLQLKSLNHISLVCRSVEKSLEFYQHVLGFFPIRRPGSFDFDGAWLFGYGIGIHLLQSEDPESMPKICVINPKDNHISFQCESMATVEKKLKE
MEIEYVKGRVEEGGIYVDQLFFHDPDGSMIEICNCDNLPVVPLSGEAIRSCSLINCTIQQQQQQKELLNQLCK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G80160 GLYI7 glyoxylase I 7, Lactoylglutath... Lus10014480 0 1
AT5G03860 MLS malate synthase (.1.2) Lus10020565 7.9 0.9509
AT4G32480 Protein of unknown function (D... Lus10011174 7.9 0.9532
AT3G11570 TBL8 TRICHOME BIREFRINGENCE-LIKE 8 ... Lus10004225 9.5 0.9477
AT3G54570 Plant calmodulin-binding prote... Lus10024175 15.9 0.8709
AT4G26400 RING/U-box superfamily protein... Lus10043027 17.0 0.9463
AT1G12780 ATUGE1, UGE1 A. THALIANA UDP-GLC 4-EPIMERAS... Lus10029572 17.3 0.9475
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10000441 17.7 0.9445
AT1G60010 unknown protein Lus10030835 19.6 0.9439
AT1G16350 Aldolase-type TIM barrel famil... Lus10036443 20.1 0.9422
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011979 26.1 0.9406

Lus10014480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.