Lus10014502 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G28480 398 / 4e-140 Oxoglutarate/iron-dependent oxygenase (.1.2)
AT3G28490 352 / 3e-122 Oxoglutarate/iron-dependent oxygenase (.1)
AT5G18900 331 / 4e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT3G06300 322 / 2e-110 P4H2, AT-P4H-2 prolyl 4-hydroxylase 2, P4H isoform 2 (.1)
AT2G17720 245 / 2e-80 P4H5 prolyl 4-hydroxylase 5, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT1G20270 243 / 8e-80 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT4G35810 243 / 2e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
AT5G66060 234 / 3e-76 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
AT4G25600 202 / 8e-64 Oxoglutarate/iron-dependent oxygenase (.1)
AT2G43080 187 / 9e-58 AT-P4H-1 P4H isoform 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032183 520 / 0 AT3G28480 434 / 3e-154 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10012014 334 / 4e-115 AT5G18900 448 / 2e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10016271 328 / 6e-113 AT5G18900 444 / 2e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10032184 238 / 7e-80 AT3G28480 206 / 2e-67 Oxoglutarate/iron-dependent oxygenase (.1.2)
Lus10028404 235 / 2e-76 AT5G66060 486 / 8e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10041857 235 / 2e-76 AT5G66060 488 / 2e-176 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Lus10005620 218 / 2e-69 AT1G20270 465 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10017249 204 / 2e-63 AT1G20270 455 / 3e-162 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Lus10038855 195 / 6e-60 AT4G25600 250 / 2e-81 Oxoglutarate/iron-dependent oxygenase (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G075100 412 / 8e-146 AT3G28480 436 / 3e-155 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.008G197700 331 / 4e-114 AT5G18900 448 / 3e-160 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.017G075300 320 / 2e-110 AT3G28480 345 / 5e-120 Oxoglutarate/iron-dependent oxygenase (.1.2)
Potri.005G108000 241 / 9e-79 AT5G66060 405 / 1e-143 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.005G245300 237 / 3e-77 AT1G20270 483 / 3e-174 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.012G142800 231 / 1e-74 AT4G25600 278 / 4e-93 Oxoglutarate/iron-dependent oxygenase (.1)
Potri.007G060800 228 / 2e-73 AT5G66060 349 / 6e-121 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Potri.002G232100 192 / 9e-60 AT2G43080 456 / 4e-164 P4H isoform 1 (.1)
Potri.001G296800 170 / 3e-51 AT4G33910 441 / 6e-158 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Potri.007G052600 170 / 6e-51 AT4G33910 353 / 4e-123 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0213 ShK-like PF01549 ShK ShK domain-like
CL0029 Cupin PF03171 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence
>Lus10014502 pacid=23170918 polypeptide=Lus10014502 locus=Lus10014502.g ID=Lus10014502.BGIv1.0 annot-version=v1.0
ATGGAGTTCCGGTCCGGCCATAATTTCCTAGGGATTTCTCTCTGTTTCATCTTGATTTTGCCTCGCCTCGCCTTCTCAGACGAAATAGAGGGCTCAGTGC
TGAGGTTGAAATCCTCTGATCCCACCCGCGTCACTCAACTCTCCTGGCATCCAAGGGCCTTTCTGTACAAAGGATTTCTGTCAGACGCGGACTGCGAGCA
CCTTAAGGACCTGGCCAGGGACTCGCTTGAGAAATCAATGGTGGCGGATGATGAAACAGGGAAGACTATAGAGAGTGAAGAAAGAACAAGCTCTGGAACT
TTTCTTCGTAAAGCACAGGATGAAGTGGTAGCTTCCATTGAACATAGGATTGCTACCTGGACTTTCCTTCCTGTCGAAAATGGAGAGGCGATTCAAATCC
TACGCTACGAGATTGGTCAGAAGTACGAGCCACATTTTGACTATTTCAATGACGAGGTTAATCAACAGCTTGGCGGACACCGGATTGCCACTGTGTTGAT
GTATCTATCAGATGTAGCCAAGGGTGGGGAGACCGGGAAGGATTCTCTAGCGAAGCCCCATGACTGGTCTGATTGTGCAAAAGATGGTTATACAGTGAAG
CCTGAGAAGGGTGATGCTCTACTGTTCTTCAATCTCCACCCTGATGCAACCACTGATCTGACCAGTCTGCACGGGAGTTGCCCCGTTATAGAGGGGGAGA
AGTGGTCAGCAACAAAGTGGATCCACGTCAGGTCATTCGATGAATCCATATCGCAACAGCAAGAAGGAGGTTGCAACGACGAGAGCGAGAACTGCGAGAA
ATGGGCCAACGAAGGTGAGTGCGAGAAGAACCCGCAGTATATGGTTGGTACTGATAAATTCTTGGGAAACTGTAGGAAGAGTTGCAGGGTATGCTCATCT
TAG
AA sequence
>Lus10014502 pacid=23170918 polypeptide=Lus10014502 locus=Lus10014502.g ID=Lus10014502.BGIv1.0 annot-version=v1.0
MEFRSGHNFLGISLCFILILPRLAFSDEIEGSVLRLKSSDPTRVTQLSWHPRAFLYKGFLSDADCEHLKDLARDSLEKSMVADDETGKTIESEERTSSGT
FLRKAQDEVVASIEHRIATWTFLPVENGEAIQILRYEIGQKYEPHFDYFNDEVNQQLGGHRIATVLMYLSDVAKGGETGKDSLAKPHDWSDCAKDGYTVK
PEKGDALLFFNLHPDATTDLTSLHGSCPVIEGEKWSATKWIHVRSFDESISQQQEGGCNDESENCEKWANEGECEKNPQYMVGTDKFLGNCRKSCRVCSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G28480 Oxoglutarate/iron-dependent ox... Lus10014502 0 1
AT2G34090 MEE18 maternal effect embryo arrest ... Lus10000989 2.4 0.8954
AT4G35980 unknown protein Lus10042598 6.0 0.8150
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031175 6.2 0.8454
Lus10033476 6.3 0.8542
AT1G30690 Sec14p-like phosphatidylinosit... Lus10031176 8.7 0.8450
AT1G69020 Prolyl oligopeptidase family p... Lus10032378 10.5 0.8099
Lus10035529 11.6 0.8140
AT3G55240 Plant protein 1589 of unknown ... Lus10003293 11.8 0.8099
AT3G27050 unknown protein Lus10032042 11.8 0.8146
AT2G14045 unknown protein Lus10022007 13.0 0.7758

Lus10014502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.