Lus10014517 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
AT3G28200 276 / 3e-94 Peroxidase superfamily protein (.1)
AT5G47000 219 / 2e-71 Peroxidase superfamily protein (.1)
AT1G24110 211 / 5e-68 Peroxidase superfamily protein (.1)
AT4G17690 201 / 3e-64 Peroxidase superfamily protein (.1)
AT2G18980 152 / 2e-45 Peroxidase superfamily protein (.1)
AT4G37520 150 / 2e-44 Peroxidase superfamily protein (.1.2)
AT5G67400 148 / 1e-43 RHS19 root hair specific 19 (.1)
AT4G37530 147 / 2e-43 Peroxidase superfamily protein (.1.2)
AT3G49960 144 / 4e-42 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032170 394 / 3e-142 AT5G40150 280 / 2e-95 Peroxidase superfamily protein (.1)
Lus10039471 333 / 4e-118 AT5G40150 290 / 2e-99 Peroxidase superfamily protein (.1)
Lus10039445 336 / 2e-117 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10029201 237 / 9e-80 AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1)
Lus10010716 239 / 4e-79 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10004234 218 / 7e-71 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10042144 217 / 2e-70 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10013955 161 / 1e-47 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10011079 156 / 2e-46 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G351000 277 / 2e-94 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.010G036100 241 / 6e-80 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.012G076500 237 / 2e-78 AT4G17690 423 / 1e-149 Peroxidase superfamily protein (.1)
Potri.007G074700 181 / 1e-56 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.004G052100 163 / 2e-49 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.007G053400 156 / 1e-46 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.001G329200 151 / 8e-45 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.017G064100 150 / 9e-45 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.018G089900 145 / 1e-42 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.008G103200 144 / 3e-42 AT4G16270 438 / 1e-154 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10014517 pacid=23170876 polypeptide=Lus10014517 locus=Lus10014517.g ID=Lus10014517.BGIv1.0 annot-version=v1.0
ATGGTCGGCGGCCCCTTCTACGACGTCCCGCTCGGCCGCCTCGACTACCGCGTCTCCAAATCCTCCGCCGTTCCCGGAAACCTCCCGCTGCCGTCGACGC
CGATGTCGCAGATGATCGACATGTTCGCCGCCAGGGGATTCTCCGTCCAGGAGATGGTCGCCCTCAGCGGGGCCCACACCATCGGGTTCTCCCACTGTGA
AGAGTTCAGCGGAGATCTGTACAACACCACCGCCACGGCGGGAGGAAGTAATTACAACCCGCGATTTGCGGCGGCGTTGCAGAAGGCGTGCGCGAATTAC
AAGAAGGACCCGTCGATCTCGGTGTTCAACGATATAATGACGCCGAACAAGTTCGACAATGTGTACTACCAGAACTTGCCCAAGGGGCTGGGTCTGCTGG
CGTCGGACCATGGGTTGGTGAAAGACGATCGAACTCGGCCGTTCGTGGAGATGTATGCTAAGGATCAGAACAAGTTCTTCAAGGATTTCGCCGTTGCGAT
GCAGAAGCTGAGCGTGTATGGGGTGAAGACTGGGAGACGAGGTGAGATTAGGCACAGGTGCGATGCTGCCAATTGA
AA sequence
>Lus10014517 pacid=23170876 polypeptide=Lus10014517 locus=Lus10014517.g ID=Lus10014517.BGIv1.0 annot-version=v1.0
MVGGPFYDVPLGRLDYRVSKSSAVPGNLPLPSTPMSQMIDMFAARGFSVQEMVALSGAHTIGFSHCEEFSGDLYNTTATAGGSNYNPRFAAALQKACANY
KKDPSISVFNDIMTPNKFDNVYYQNLPKGLGLLASDHGLVKDDRTRPFVEMYAKDQNKFFKDFAVAMQKLSVYGVKTGRRGEIRHRCDAAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40150 Peroxidase superfamily protein... Lus10014517 0 1
AT5G40150 Peroxidase superfamily protein... Lus10032170 1.0 0.9425
AT2G38360 PRA1.B4 prenylated RAB acceptor 1.B4 (... Lus10026404 1.4 0.8974
AT4G37450 ATAGP18, AGP18 arabinogalactan protein 18 (.... Lus10011520 3.5 0.8635
AT1G08480 SDH6 succinate dehydrogenase 6, unk... Lus10008448 3.5 0.8901
AT5G62220 ATGT18 glycosyltransferase 18 (.1) Lus10031685 5.3 0.8587
AT1G14360 ATUTR3, UTR3 UDP-galactose transporter 3 (.... Lus10030495 6.3 0.8529
Lus10042355 7.4 0.8667
AT4G10250 ATHSP22.0 HSP20-like chaperones superfam... Lus10042408 7.7 0.8463
AT3G23820 GAE6 UDP-D-glucuronate 4-epimerase ... Lus10016640 8.5 0.8734
AT5G52020 AP2_ERF Integrase-type DNA-binding sup... Lus10031655 8.9 0.7830

Lus10014517 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.