Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14920 41 / 4e-05 Gibberellin-regulated family protein (.1.2) AT2G18420 39 / 6e-05 Gibberellin-regulated family protein (.1) AT1G75750 39 / 0.0001 GASA1 GAST1 protein homolog 1 (.1.2) AT1G22690 39 / 0.0002 Gibberellin-regulated family protein (.1.2.3) AT4G09600 38 / 0.0002 GASA3 GAST1 protein homolog 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032168 [exp] 174 / 9e-58 AT5G14920 44 / 7e-06 Gibberellin-regulated family protein (.1.2) Lus10039443 [exp] 45 / 2e-06 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10017212 [exp] 39 / 6e-05 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10034524 [exp] 38 / 0.0003 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G113400 [exp] 43 / 3e-06 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.001G350600 [exp] 44 / 4e-06 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2) Potri.005G239100 [exp] 42 / 5e-06 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.012G076700 [exp] 39 / 0.0001 AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) Potri.002G022700 [exp] 38 / 0.0002 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.002G022500 [exp] 38 / 0.0003 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.015G071500 [exp] 38 / 0.0003 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.002G022600 [exp] 37 / 0.0003 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.017G124200 [exp] 36 / 0.001 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10014519 pacid=23170882 polypeptide=Lus10014519 locus=Lus10014519.g ID=Lus10014519.BGIv1.0 annot-version=v1.0 ATGGCTCTCATCAAAGCTGCCTTCATCCTCTTCTTCCTAGCCTACCTCACGTCCAATGTTTATTCAGCTGAAGTAGCTTCTGAGGAATCTCCAGCTGCTG TCGTCGCTGCTGCTGATGCTCCGGTGTACGTAGCGCAGTCACCAATGTCGAATTTCCGAGGAGACTACTGCCTCGACAGGTGCGAGGACCGGTGCAAGAC GCACCCGAGCAAGAAGAGGATGTGCCAGAAGCTATGCACAAGGTGTTGCATGAGCTGCAAGTGTGTGCCGCCTGGCCCTGTTGGTACCAATGCTGATAAG TGCAAGAACTGGACCGCCACTGTTTACAAAGGCCTCCCTTACATTTGCCCTTAA
AA sequence Show only first row Show all	>Lus10014519 pacid=23170882 polypeptide=Lus10014519 locus=Lus10014519.g ID=Lus10014519.BGIv1.0 annot-version=v1.0 MALIKAAFILFFLAYLTSNVYSAEVASEESPAAVVAAADAPVYVAQSPMSNFRGDYCLDRCEDRCKTHPSKKRMCQKLCTRCCMSCKCVPPGPVGTNADK CKNWTATVYKGLPYICP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14920			Gibberellin-regulated family p...		Lus10014519 [exp]	0	1
AT5G20260			Exostosin family protein (.1)		Lus10005186 [exp]	1.4	0.9422
AT4G12840			Protein of unknown function (D...		Lus10008748 [exp]	2.0	0.9034
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10024648 [exp]	4.2	0.9032
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Lus10009782 [exp]	5.3	0.8929
AT1G77410		BGAL16	beta-galactosidase 16 (.1)		Lus10008259 [exp]	10.5	0.8113
AT1G13620		RGF2	root meristem growth factor 2,...		Lus10019202 [exp]	10.5	0.8391
					Lus10022643 [exp]	11.3	0.8468
AT1G32100		ATPRR1	pinoresinol reductase 1 (.1)		Lus10012147 [exp]	13.7	0.7815
AT3G05390			unknown protein		Lus10004494 [exp]	14.8	0.8802
AT5G04220		SYT3, NTMCTYPE1...	synaptotagmin 3, Calcium-depen...		Lus10026515 [exp]	14.9	0.8536

Compare expression of checked genes

Lus10014519 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.