Lus10014530 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G11770 315 / 2e-110 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
ATCG00430 138 / 1e-40 ATCG00430.1, PSBG photosystem II reaction center protein G (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039485 348 / 3e-123 AT5G11770 352 / 4e-125 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Lus10032157 247 / 9e-85 AT5G11770 277 / 7e-97 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Lus10032155 247 / 9e-85 AT5G11770 277 / 7e-97 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Lus10032156 75 / 9e-18 AT5G11770 47 / 6e-08 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G231701 315 / 3e-110 AT5G11770 303 / 7e-106 NADH-ubiquinone oxidoreductase 20 kDa subunit, mitochondrial (.1)
Potri.013G163100 136 / 1e-39 ATCG00430 409 / 4e-147 photosystem II reaction center protein G (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
Representative CDS sequence
>Lus10014530 pacid=23170871 polypeptide=Lus10014530 locus=Lus10014530.g ID=Lus10014530.BGIv1.0 annot-version=v1.0
ATGGCTATGATCACCAGAAACACCGCCTCTCGCCTCCCTATCCTCCTCGCCAACCACCGTGCTGGCCTCGCAGCTGCTCTCCACACCACCGTCCCCTCGC
CATCCCCTGATAACGCAACCAAACCGACTTCCTACGCCCCGCCACCGCCTCCGGCTACCTCTTCCCCCGCTGGCCTCTCCAAGACGGCCGAATTCGTGAT
CTCCAAGGTCGATGATGTCATCAACTATGTCCGCCGAGGATCCATCTGGCCAATGACTTTCGGGCTCGCTTGCTGCGCTGTCGAGATGATGCACACGGGT
GCGGCACGCTACGATCTGGATCGGTTTGGTGTCATTTTCAGGCCTAGCCCTCGCCAGTCTGATTGTATGATTGTCGCCGGCACCTTAACTAACAAGATGG
CTCCTGCTCTTCGCAAGGTGTACGACCAAATGCCGGAGCCGAGATGGGTAATCTCCATGGGAAGCTGTGCAAATGGTGGCGGCTACTATCACTACTCGTA
CTCCGTTGTACGCGGTTGCGACAGGATTGTCCCCGTTGACATATATGTTCCAGGGTGCCCTCCGACTGCCGAGGCACTACTCTATGGAATACTCCAGCTG
CAGAAAAAGATTAACAGACGCAAAGATCTCATGCATTGGTGGACTAAGTAA
AA sequence
>Lus10014530 pacid=23170871 polypeptide=Lus10014530 locus=Lus10014530.g ID=Lus10014530.BGIv1.0 annot-version=v1.0
MAMITRNTASRLPILLANHRAGLAAALHTTVPSPSPDNATKPTSYAPPPPPATSSPAGLSKTAEFVISKVDDVINYVRRGSIWPMTFGLACCAVEMMHTG
AARYDLDRFGVIFRPSPRQSDCMIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGILQL
QKKINRRKDLMHWWTK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10014530 0 1
AT2G16770 bZIP bZIP23 Basic-leucine zipper (bZIP) tr... Lus10027847 1.7 0.8708
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10020390 2.0 0.8608
AT2G19270 unknown protein Lus10015539 3.5 0.8424
AT5G14280 GeBP DNA-binding storekeeper protei... Lus10014607 5.7 0.8082
AT5G08060 unknown protein Lus10034681 5.7 0.8354
AT1G13950 EIF5A, ATELF5A-... eukaryotic elongation factor 5... Lus10036801 6.9 0.7948
AT1G29790 S-adenosyl-L-methionine-depend... Lus10015264 7.4 0.8344
AT5G60200 DOF TMO6, AtDof5,3 TARGET OF MONOPTEROS 6 (.1) Lus10014001 9.5 0.8066
AT3G07480 2Fe-2S ferredoxin-like superfa... Lus10009568 12.2 0.7808
AT4G10810 unknown protein Lus10023038 13.9 0.8287

Lus10014530 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.