Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G14680 296 / 5e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G01520 275 / 1e-95 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G11930 83 / 4e-20 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) AT3G58450 80 / 6e-19 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT1G68300 77 / 3e-18 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G62550 74 / 4e-17 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT1G09740 70 / 4e-15 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT3G03270 62 / 3e-12 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G53990 59 / 3e-11 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT3G17020 54 / 3e-09 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032142 [exp] 357 / 4e-128 AT5G14680 296 / 3e-104 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10008772 [exp] 204 / 5e-67 AT5G14680 189 / 3e-61 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10041436 [exp] 86 / 1e-21 AT1G68300 159 / 2e-50 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10034337 [exp] 81 / 1e-19 AT1G68300 164 / 2e-52 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029310 [exp] 76 / 3e-17 AT3G11930 197 / 2e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Lus10009272 [exp] 73 / 2e-16 AT1G09740 227 / 6e-77 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029850 [exp] 70 / 1e-14 AT3G62550 140 / 5e-42 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Lus10029849 [exp] 66 / 9e-13 AT2G47430 489 / 2e-153 CYTOKININ-INDEPENDENT 1, Signal transduction histidine kinase (.1) Lus10025033 [exp] 64 / 1e-12 AT3G62550 186 / 1e-60 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G071700 [exp] 313 / 7e-111 AT5G14680 298 / 6e-105 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.008G121900 [exp] 87 / 5e-22 AT1G68300 188 / 5e-62 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.016G064000 [exp] 87 / 1e-21 AT3G11930 214 / 4e-71 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.006G198200 [exp] 85 / 7e-21 AT3G11930 209 / 9e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2.3.4) Potri.010G123200 [exp] 82 / 5e-20 AT1G68300 173 / 5e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.010G123400 [exp] 74 / 1e-16 AT1G68300 115 / 3e-33 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.014G122000 [exp] 73 / 1e-16 AT3G62550 195 / 1e-64 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.005G015200 [exp] 72 / 3e-16 AT3G62550 156 / 4e-49 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G104700 [exp] 71 / 1e-15 AT1G09740 251 / 2e-86 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) Potri.002G196700 [exp] 70 / 3e-15 AT3G62550 196 / 6e-65 Adenine nucleotide alpha hydrolases-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0039 [flax] [poplar] HUP PF00582 [flax] [poplar] Usp Universal stress protein family
Representative CDS sequence Show only first row Show all	>Lus10014545 pacid=23170875 polypeptide=Lus10014545 locus=Lus10014545.g ID=Lus10014545.BGIv1.0 annot-version=v1.0 ATGGAAGGCCCGCCGACTAGGATCATGATCGCAGTGAATGAGTCGTCGATCAAGAAGTATCCGCATCCTTCCATCAGTAGCAGAGGCGCTTTTGACTGGT CTCTTGAGAAGATTGTTCGCTCCAACACTTCTGGATTCAAGCTCCTCTTCCTCCATGTTCAAGTCCCCGACGAAGATGGTTTCGATGACATGGATAGCAT ATATGCATCTCCTGATGATTTCAAGCAGATGGCTCGTAGGGACAAGGCTAGAGGTCTGCACTTGCTGGAGTATTTCGTTGATAGATGCCACGAGATTGGG ATTGCTTGTGAGTCCTGGATTAAGAAGGGTGACCCAAAAGAAGTAATCTGTCATGAAGTGAAGCGAGTGAAACCGGATCTCCTCATTGTTGGAAGCAGGG GTCTTGGTCCTTTCCAAAGGGTGTTTGTTGGGACAGTGAGTGAATTTGCGCTGAAACATGCAGAGTGTCCCGTGGTCATAATCAAACGCGATGCTGGCGA AACCCCGCAGGATCCAGTCGATGACTGA
AA sequence Show only first row Show all	>Lus10014545 pacid=23170875 polypeptide=Lus10014545 locus=Lus10014545.g ID=Lus10014545.BGIv1.0 annot-version=v1.0 MEGPPTRIMIAVNESSIKKYPHPSISSRGAFDWSLEKIVRSNTSGFKLLFLHVQVPDEDGFDDMDSIYASPDDFKQMARRDKARGLHLLEYFVDRCHEIG IACESWIKKGDPKEVICHEVKRVKPDLLIVGSRGLGPFQRVFVGTVSEFALKHAECPVVIIKRDAGETPQDPVDD

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G14680			Adenine nucleotide alpha hydro...		Lus10014545 [exp]	0	1
AT1G16560			Per1-like family protein (.1.2...		Lus10031187 [exp]	2.8	0.8172
AT3G21640		FKBP42, UCU2, T...	ULTRACURVATA 2, TWISTED DWARF ...		Lus10039604 [exp]	3.5	0.8341
AT3G61440		ATCYSC1, ARATH;...	BETA-SUBSTITUTED ALA SYNTHASE ...		Lus10014765 [exp]	3.9	0.8488
AT3G59990		MAP2B	methionine aminopeptidase 2B (...		Lus10010592 [exp]	7.5	0.8366
AT4G18040		LSP1, CUM1, AT....	eukaryotic translation Initiat...		Lus10015247 [exp]	7.9	0.7884
AT1G16810			unknown protein		Lus10033383 [exp]	9.2	0.8230
AT1G16740			Ribosomal protein L20 (.1)		Lus10006327 [exp]	11.6	0.7927
AT4G13520		SMAP1	small acidic protein 1 (.1)		Lus10004400 [exp]	13.5	0.8073
AT4G08460			Protein of unknown function (D...		Lus10009772 [exp]	15.8	0.8153
AT1G53850		PAE1, ATPAE1	ARABIDOPSIS 20S PROTEASOME ALP...		Lus10003936 [exp]	17.7	0.8063

Compare expression of checked genes

Lus10014545 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.