Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61770 89 / 3e-23 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) AT3G12685 58 / 1e-11 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) AT1G67600 53 / 3e-10 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) AT1G24350 52 / 5e-10 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3) AT3G21610 47 / 2e-08 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030253 [exp] 91 / 5e-25 AT3G61770 245 / 5e-83 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10001841 [exp] 57 / 5e-11 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10001756 [exp] 56 / 7e-11 AT3G12685 206 / 2e-66 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10000883 [exp] 52 / 8e-10 AT3G21610 224 / 3e-76 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10003670 [exp] 52 / 1e-09 AT3G21610 219 / 1e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Lus10036984 [exp] 51 / 1e-09 AT1G24350 185 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2.3) Lus10011373 [exp] 51 / 2e-09 AT1G67600 245 / 2e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10006432 [exp] 51 / 2e-09 AT1G67600 245 / 3e-84 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Lus10030025 [exp] 49 / 3e-08 AT3G21610 243 / 6e-82 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G171300 [exp] 93 / 2e-24 AT3G61770 331 / 3e-114 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Potri.010G176100 [exp] 59 / 7e-12 AT3G12685 193 / 2e-61 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Potri.010G056600 [exp] 52 / 9e-10 AT1G67600 254 / 8e-88 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1) Potri.011G087100 [exp] 51 / 2e-09 AT3G21610 204 / 9e-68 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Potri.014G156000 [exp] 49 / 2e-08 AT3G21610 184 / 5e-60 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2) Potri.002G226900 [exp] 49 / 2e-08 AT3G21610 218 / 2e-73 Acid phosphatase/vanadium-dependent haloperoxidase-related protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0525 [flax] [poplar] pap2 PF02681 [flax] [poplar] DUF212 Divergent PAP2 family
Representative CDS sequence Show only first row Show all	>Lus10014550 pacid=23170932 polypeptide=Lus10014550 locus=Lus10014550.g ID=Lus10014550.BGIv1.0 annot-version=v1.0 ATGTTTGAACTTCTTTGTGGAGAGGAAATGGGATTTCAGGATTCTTTTTGTTCCGGTGGGATGCCGTCTTCCCACTCTGCTCTGTGTACTGCTTTGACTA CGGCCGTGGCTCTCTGTCATGGCGTGGCGGATTCTTTATTTCCGGTTTGTTTGGGGTTTAGCCTTGTTGTTATGTACGATGCTATTGGCGTCAGGCGCCA TGCTGGGATGCAAGCTAAGGTGAGGAAAAGTTTGATTGTGCCAGCTTAG
AA sequence Show only first row Show all	>Lus10014550 pacid=23170932 polypeptide=Lus10014550 locus=Lus10014550.g ID=Lus10014550.BGIv1.0 annot-version=v1.0 MFELLCGEEMGFQDSFCSGGMPSSHSALCTALTTAVALCHGVADSLFPVCLGFSLVVMYDAIGVRRHAGMQAKVRKSLIVPA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G61770			Acid phosphatase/vanadium-depe...		Lus10014550 [exp]	0	1
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10006555 [exp]	15.3	0.6791
AT1G47890		AtRLP7	receptor like protein 7 (.1)		Lus10004309 [exp]	22.4	0.6299
AT5G14610			DEAD box RNA helicase family p...		Lus10035149 [exp]	33.1	0.6167
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10000717 [exp]	44.7	0.6166
					Lus10032721 [exp]	55.6	0.5990
AT1G69930		ATGSTU11	glutathione S-transferase TAU ...		Lus10029518 [exp]	62.6	0.5915
AT1G12920		ERF1-2	eukaryotic release factor 1-2 ...		Lus10028313 [exp]	82.9	0.5153
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028944 [exp]	92.4	0.5519
AT1G07230		NPC1	non-specific phospholipase C1 ...		Lus10018228 [exp]	107.7	0.5714
AT4G16835			Tetratricopeptide repeat (TPR)...		Lus10000596 [exp]	117.6	0.5120

Compare expression of checked genes

Lus10014550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.