Lus10014559 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40420 118 / 1e-33 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G01570 105 / 5e-29 Oleosin family protein (.1)
AT3G27660 105 / 7e-29 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT2G25890 57 / 2e-10 Oleosin family protein (.1)
AT5G51210 54 / 1e-09 OLEO3 oleosin3 (.1)
AT4G25140 54 / 3e-09 OLE1, OLEO1 oleosin 1 (.1)
AT5G07550 44 / 4e-06 ATGRP19, GRP19 glycine-rich protein 19 (.1.2.3)
AT5G61610 45 / 6e-06 Oleosin family protein (.1)
AT5G07571 42 / 4e-05 Oleosin family protein (.1)
AT5G07540 41 / 0.0001 ATGRP16, ATGRP-6, GRP16 glycine-rich protein 16 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032127 242 / 9e-83 AT3G01570 162 / 4e-51 Oleosin family protein (.1)
Lus10028035 107 / 3e-29 AT3G01570 139 / 8e-42 Oleosin family protein (.1)
Lus10003742 105 / 5e-29 AT3G01570 142 / 1e-43 Oleosin family protein (.1)
Lus10028822 71 / 4e-16 AT4G25140 146 / 3e-46 oleosin 1 (.1)
Lus10017460 72 / 5e-16 AT4G25140 136 / 9e-42 oleosin 1 (.1)
Lus10031387 68 / 1e-14 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10027161 65 / 2e-13 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10010943 67 / 3e-13 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10039683 64 / 7e-13 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G345800 141 / 3e-43 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Potri.017G071800 134 / 1e-40 AT3G01570 130 / 4e-39 Oleosin family protein (.1)
Potri.012G083400 108 / 2e-30 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.015G081901 104 / 1e-28 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 104 / 1e-28 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.006G234900 58 / 8e-11 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.003G150600 55 / 6e-10 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.001G080000 55 / 8e-10 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.018G057800 52 / 7e-09 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.012G059400 40 / 0.0003 AT3G18570 113 / 4e-32 Oleosin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Lus10014559 pacid=23170860 polypeptide=Lus10014559 locus=Lus10014559.g ID=Lus10014559.BGIv1.0 annot-version=v1.0
ATGGCGGATCGTACAACGCAGCCACACCAAGTCCAGGTCCACACCCAGCACCACTACCCTACAGGCGGCGCTTTCGGCCGTTATGAAGGTGTACTCAAAG
GCGGTCCATATCACCAGCAAGGGACAGGAAGCGGCCCTTCAGCTTCCAAGGTGCTAGCAGTCATGACCGCGCTCCCCATCGGTGGGACCCTCCTTGCCCT
GGCCGGGATTACCTTGGCCGGGACGATGATCGGGCTGGCGATCACCACCCCAATTTTCGTCATCTGCAGCCCGGTTCTCGTCCCGGCCGCTCTGCTCATC
GGGTTTGCGGTGAGCGCGTTCTTGGCCTCGGGGATGGCAGGGCTGACAGGGCTGACCTCGCTGTCGTGGTTTGCGAGGTATCTGCAGCAGGCTGGGCAGG
GGGTTGGGGTTGGGGTGCCGGACAGTTTCGATCAGGCAAAGAGGCGCATGCAGGATGCTGCTGGGTATATGGGGCAGAAGACTAAGGAAGTTGGGCAGGA
GATCCAGAGGAAGTCTCAGGATGTGAAAGCATCTGACAAATAA
AA sequence
>Lus10014559 pacid=23170860 polypeptide=Lus10014559 locus=Lus10014559.g ID=Lus10014559.BGIv1.0 annot-version=v1.0
MADRTTQPHQVQVHTQHHYPTGGAFGRYEGVLKGGPYHQQGTGSGPSASKVLAVMTALPIGGTLLALAGITLAGTMIGLAITTPIFVICSPVLVPAALLI
GFAVSAFLASGMAGLTGLTSLSWFARYLQQAGQGVGVGVPDSFDQAKRRMQDAAGYMGQKTKEVGQEIQRKSQDVKASDK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G01570 Oleosin family protein (.1) Lus10014559 0 1
AT5G49690 UDP-Glycosyltransferase superf... Lus10008955 3.5 0.8811
AT5G24930 CO COL4, ATCOL4 CONSTANS-like 4 (.1) Lus10042431 3.7 0.9037
AT3G17020 Adenine nucleotide alpha hydro... Lus10037761 5.2 0.8706
AT4G28570 Long-chain fatty alcohol dehyd... Lus10022903 7.1 0.8570
AT1G22360 ATUGT85A2, AT2 UDP-glucosyl transferase 85A2 ... Lus10000632 12.5 0.8375
AT3G47300 SELT SELT-like protein precursor (.... Lus10002479 13.0 0.8133
AT3G21750 UGT71B1 UDP-glucosyl transferase 71B1 ... Lus10026795 16.9 0.8665
AT5G13770 Pentatricopeptide repeat (PPR-... Lus10035089 18.8 0.8540
AT4G29110 unknown protein Lus10014153 20.8 0.8411
AT3G55760 unknown protein Lus10021897 21.7 0.8483

Lus10014559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.