Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63270 71 / 3e-18 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G55850 69 / 7e-17 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) AT5G40645 67 / 2e-16 RPM1-interacting protein 4 (RIN4) family protein (.1) AT4G35655 66 / 3e-16 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G04410 64 / 2e-15 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G48450 64 / 4e-15 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G17660 60 / 8e-14 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G25070 48 / 2e-08 RIN4 RPM1 interacting protein 4 (.1) AT5G19473 39 / 3e-05 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032112 [exp] 115 / 3e-35 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10022524 [exp] 67 / 1e-16 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10016623 [exp] 67 / 2e-16 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10006361 [exp] 66 / 6e-16 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10012316 [exp] 66 / 6e-16 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10025949 [exp] 64 / 2e-15 AT2G17660 87 / 2e-24 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10040889 [exp] 52 / 6e-10 AT1G53000 147 / 6e-44 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10022776 [exp] 49 / 2e-08 AT3G25070 155 / 4e-47 RPM1 interacting protein 4 (.1) Lus10011841 [exp] 49 / 2e-08 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G338500 [exp] 73 / 6e-19 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.012G092601 [exp] 72 / 4e-18 AT2G04410 78 / 3e-20 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.015G089201 [exp] 71 / 5e-18 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.001G368900 [exp] 67 / 8e-17 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.011G094200 [exp] 69 / 1e-16 AT5G55850 123 / 8e-38 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.014G168900 [exp] 66 / 3e-16 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.002G245400 [exp] 49 / 2e-08 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1) Potri.004G002500 [exp] 45 / 3e-07 AT3G25070 75 / 1e-16 RPM1 interacting protein 4 (.1) Potri.011G022000 [exp] 45 / 3e-07 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [flax] [poplar] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Lus10014574 pacid=23170901 polypeptide=Lus10014574 locus=Lus10014574.g ID=Lus10014574.BGIv1.0 annot-version=v1.0 ATGGCTCAGCAAGATGCAAGACCTTTGCCCAAATTTGGGGAGTGGGATGTGAACAATCCAGCATCTGCAGAAGGATTCACTGTAATATTCAGCAAAGCCA GAGATGAGAAGAAGGCAGGAGCCACTACTGGTGGAGCTGGAGCTGCTTCTCAGAGGAACAAAGGCCCTTCTAAAGACCAAGATTATCAAAACTCCCCATC TGTATGA
AA sequence Show only first row Show all	>Lus10014574 pacid=23170901 polypeptide=Lus10014574 locus=Lus10014574.g ID=Lus10014574.BGIv1.0 annot-version=v1.0 MAQQDARPLPKFGEWDVNNPASAEGFTVIFSKARDEKKAGATTGGAGAASQRNKGPSKDQDYQNSPSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55850		NOI	RPM1-interacting protein 4 (RI...		Lus10014574 [exp]	0	1

Compare expression of checked genes

Lus10014574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.