Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17230 69 / 2e-15 PSY PHYTOENE SYNTHASE (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039186 [exp] 103 / 2e-28 AT5G17230 442 / 1e-154 PHYTOENE SYNTHASE (.1.2.3) Lus10013753 [exp] 102 / 7e-28 AT5G17230 446 / 4e-156 PHYTOENE SYNTHASE (.1.2.3) Lus10020729 [exp] 69 / 1e-15 AT5G17230 491 / 7e-174 PHYTOENE SYNTHASE (.1.2.3) Lus10029809 [exp] 69 / 1e-15 AT5G17230 491 / 3e-172 PHYTOENE SYNTHASE (.1.2.3) Lus10001050 [exp] 66 / 2e-14 AT5G17230 535 / 0.0 PHYTOENE SYNTHASE (.1.2.3) Lus10001416 [exp] 64 / 1e-13 AT5G17230 545 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G217950 [exp] 81 / 8e-20 AT5G17230 443 / 5e-155 PHYTOENE SYNTHASE (.1.2.3) Potri.001G007700 [exp] 77 / 2e-18 AT5G17230 443 / 4e-155 PHYTOENE SYNTHASE (.1.2.3) Potri.003G218000 [exp] 74 / 2e-17 AT5G17230 411 / 2e-142 PHYTOENE SYNTHASE (.1.2.3) Potri.002G056800 [exp] 71 / 3e-16 AT5G17230 555 / 0.0 PHYTOENE SYNTHASE (.1.2.3) Potri.005G205800 [exp] 69 / 2e-15 AT5G17230 549 / 0.0 PHYTOENE SYNTHASE (.1.2.3) Potri.017G138900 [exp] 68 / 2e-15 AT5G17230 630 / 0.0 PHYTOENE SYNTHASE (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014576 pacid=23170935 polypeptide=Lus10014576 locus=Lus10014576.g ID=Lus10014576.BGIv1.0 annot-version=v1.0 ATGAGAGCTCAGATCACTAGAGCAAGATCCTACTTCAGCCTCGCCGAGGAAGGTGCCTCACACCTCGATGATGCTAGCTGTTGGCCGGTGTGGACAGCTC TGTTGGTGGATAGAGAGATATTGGACAAGATCGAAGAGAATGATTCCAACTACTTGGACAAGAGAGCTGATGTTGGGAAGGCCAATTAG
AA sequence Show only first row Show all	>Lus10014576 pacid=23170935 polypeptide=Lus10014576 locus=Lus10014576.g ID=Lus10014576.BGIv1.0 annot-version=v1.0 MRAQITRARSYFSLAEEGASHLDDASCWPVWTALLVDREILDKIEENDSNYLDKRADVGKAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G17230		PSY	PHYTOENE SYNTHASE (.1.2.3)		Lus10014576 [exp]	0	1

Compare expression of checked genes

Lus10014576 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.