Lus10014590 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G45790 89 / 7e-22 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2)
AT4G33495 48 / 6e-07 RPD1 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10005755 50 / 8e-08 AT4G33495 608 / 0.0 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1)
Lus10027440 50 / 1e-07 AT4G33495 607 / 0.0 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G030300 89 / 2e-21 AT5G45790 466 / 8e-163 Ubiquitin carboxyl-terminal hydrolase family protein (.1.2)
Potri.015G141700 51 / 5e-08 AT4G33495 607 / 0.0 ROOT PRIMORDIUM DEFECTIVE 1, Ubiquitin carboxyl-terminal hydrolase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11955 PORR Plant organelle RNA recognition domain
Representative CDS sequence
>Lus10014590 pacid=23170892 polypeptide=Lus10014590 locus=Lus10014590.g ID=Lus10014590.BGIv1.0 annot-version=v1.0
ATGTTGGGTACTTATAATGTCAATTTACCGCTATTAAGGACAAAACTGTCTTTCCCCTTCCCTCCCACCTTCTTCCTCTTCCGCCTAGTCGCGTACAGCA
ACTCGCCGCCGCCGTATCAATTCTGTCACCTCCACCGTATCCAGTCTGCCACTGCCGTATTCAGCCGCATCGACGCTGTCTTCCTTCTCTTAGGGGATGC
AATATATTGGAAGTATCTTCTGAAAATTTCTACTACCTTGTATTGGTGGCTGAATGTCAAGAGGGATGAGAGTTTAGGCCTGGCAGAGATCGAAAAATGG
AGAGAGAAGGAGTACAAAGACAAGTGGCTGAGTGAACTTGAGACGAATTATGCATTTCGCATTCATTATCCGACAGGGTTTAAGATTAAGGGAGGCCTTA
GAGAGCAGATGCTGAATTGGCAAAGGGTTCCTTGA
AA sequence
>Lus10014590 pacid=23170892 polypeptide=Lus10014590 locus=Lus10014590.g ID=Lus10014590.BGIv1.0 annot-version=v1.0
MLGTYNVNLPLLRTKLSFPFPPTFFLFRLVAYSNSPPPYQFCHLHRIQSATAVFSRIDAVFLLLGDAIYWKYLLKISTTLYWWLNVKRDESLGLAEIEKW
REKEYKDKWLSELETNYAFRIHYPTGFKIKGGLREQMLNWQRVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G45790 Ubiquitin carboxyl-terminal hy... Lus10014590 0 1
AT1G11340 S-locus lectin protein kinase ... Lus10015424 10.0 0.7573
AT2G31290 Ubiquitin carboxyl-terminal hy... Lus10003062 19.0 0.7269
AT5G53760 ATMLO11, MLO11 MILDEW RESISTANCE LOCUS O 11, ... Lus10043085 54.1 0.6391
AT5G60410 ATSIZ1, SIZ1 DNA-binding protein with MIZ/S... Lus10038464 61.5 0.6793
AT1G72660 P-loop containing nucleoside t... Lus10015662 63.5 0.6636
Lus10031222 66.5 0.6490
AT1G13630 Tetratricopeptide repeat (TPR)... Lus10019200 70.1 0.5851
AT1G67170 unknown protein Lus10035371 91.5 0.6603
AT1G14740 Protein of unknown function (D... Lus10030771 93.4 0.6121
AT5G35560 DENN (AEX-3) domain-containing... Lus10033443 98.9 0.6486

Lus10014590 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.