Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032082 [exp] 114 / 2e-31 AT4G15415 726 / 0.0 Protein phosphatase 2A regulatory B subunit family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G070100 [exp] 62 / 1e-12 AT1G13460 728 / 0.0 Protein phosphatase 2A regulatory B subunit family protein (.1.2) Potri.010G054300 [exp] 49 / 5e-08 AT3G26020 746 / 0.0 Protein phosphatase 2A regulatory B subunit family protein (.1.2.3.4) Potri.008G180000 [exp] 38 / 0.0004 AT3G26020 711 / 0.0 Protein phosphatase 2A regulatory B subunit family protein (.1.2.3.4)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014618 pacid=23170879 polypeptide=Lus10014618 locus=Lus10014618.g ID=Lus10014618.BGIv1.0 annot-version=v1.0 ATGATTAAACAGTTCTTCAATAGGCTTCCACGGAAGCCATCAAAGTCATCTGAGAATCGAAATGGTGGGGGAACCTCTACATCCTCATCAAACACTTCGA CTGGCTCTACCAACGAGAGATATGGGGGAATGAATGCCAGCTCGGTGCCTGCCGTCAATTTGAATCCAGCTCACGGGAATAAGCTCTCTCTACCAGGAAA CATGAAGCTGAATGGTAATCAACCTGCTCCTTCTTTCGAGGCCTTGCCTAGCTTCCGGGCAGTTCCAGATGCCGAGTAG
AA sequence Show only first row Show all	>Lus10014618 pacid=23170879 polypeptide=Lus10014618 locus=Lus10014618.g ID=Lus10014618.BGIv1.0 annot-version=v1.0 MIKQFFNRLPRKPSKSSENRNGGGTSTSSSNTSTGSTNERYGGMNASSVPAVNLNPAHGNKLSLPGNMKLNGNQPAPSFEALPSFRAVPDAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15415		ATB'GAMMA, ATB'...	Protein phosphatase 2A regulat...		Lus10014618 [exp]	0	1
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10013468 [exp]	2.0	0.9008
AT3G58050			unknown protein		Lus10016244 [exp]	6.2	0.8703
AT5G37510		CI76, EMB1467	embryo defective 1467, NADH-ub...		Lus10000183 [exp]	9.9	0.8699
AT4G39080		VHA-A3	vacuolar proton ATPase A3 (.1)		Lus10028796 [exp]	10.0	0.8600
AT4G19180			GDA1/CD39 nucleoside phosphata...		Lus10034777 [exp]	10.6	0.8646
AT4G37270		ATHMA1, HMA1	ARABIDOPSIS THALIANA HEAVY MET...		Lus10019313 [exp]	12.8	0.8347
AT3G10370		SDP6	SUGAR-DEPENDENT 6, FAD-depende...		Lus10007931 [exp]	13.4	0.8372
AT1G11390			Protein kinase superfamily pro...		Lus10018416 [exp]	13.5	0.8511
AT4G27060		CN, SPR2, TOR1	TORTIFOLIA 1, SPIRAL 2, CONVOL...		Lus10040047 [exp]	15.0	0.8204
AT5G05170		IXR1, CEV1, ATH...	ISOXABEN RESISTANT 1, CONSTIT...		Lus10012198 [exp]	15.5	0.8456

Compare expression of checked genes

Lus10014618 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.