Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G38435 57 / 9e-12 SPH8 S-protein homologue 8 (.1) AT2G23148 56 / 7e-11 Plant self-incompatibility protein S1 family (.1) AT2G06090 55 / 1e-10 Plant self-incompatibility protein S1 family (.1) AT5G38440 52 / 8e-10 Plant self-incompatibility protein S1 family (.1) AT4G29035 52 / 2e-09 Plant self-incompatibility protein S1 family (.1) AT3G26880 51 / 3e-09 Plant self-incompatibility protein S1 family (.1) AT4G16295 49 / 2e-08 SPH1 S-protein homologue 1 (.1) AT1G04645 48 / 6e-08 Plant self-incompatibility protein S1 family (.1) AT1G28306 46 / 2e-07 Plant self-incompatibility protein S1 family (.1) AT5G27238 46 / 3e-07 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033803 [exp] 172 / 3e-56 AT5G38435 45 / 3e-06 S-protein homologue 8 (.1) Lus10011892 [exp] 92 / 1e-24 AT4G16295 71 / 3e-16 S-protein homologue 1 (.1) Lus10022826 [exp] 91 / 2e-24 AT4G29035 68 / 5e-15 Plant self-incompatibility protein S1 family (.1) Lus10022824 [exp] 82 / 5e-21 AT5G04347 67 / 9e-15 Plant self-incompatibility protein S1 family (.1) Lus10011895 [exp] 76 / 2e-18 AT4G29035 72 / 3e-16 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 72 / 3e-17 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10022830 [exp] 69 / 4e-16 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1) Lus10019779 [exp] 67 / 1e-14 AT4G16295 58 / 6e-11 S-protein homologue 1 (.1) Lus10022631 [exp] 65 / 2e-14 AT3G26880 65 / 2e-14 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 75 / 3e-18 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 64 / 3e-14 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.004G199700 [exp] 55 / 2e-10 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.010G008300 [exp] 50 / 7e-09 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.001G053300 [exp] 44 / 2e-06 AT3G24060 82 / 2e-20 Plant self-incompatibility protein S1 family (.1) Potri.004G199801 [exp] 44 / 4e-06 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1) Potri.003G201300 [exp] 40 / 6e-05 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 38 / 0.0002 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 37 / 0.0005 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10014630 pacid=23149640 polypeptide=Lus10014630 locus=Lus10014630.g ID=Lus10014630.BGIv1.0 annot-version=v1.0 ATGAGCGACCCAAATTCAGTGGTGCTGGTACACTGTAAATCAAGGGATAATGATCTTGGTATTCATAACATTACCGGAGACGTCCCCTACGAATTCCGTT TCAAACCGGAGCTCATCAAGGCCACGCTCTTCTGGTGCTATGTGGCACCCTCCAACGATCGTCATGCTGCGTTTGACGCTTATTCAAATATGGCTCATTA CAGAGAGTACGACAAGAAAACCTACTGGGTCATTCTCGATGATGGTGTCTACTTGTCAAATCGTAATGAAGATGGCAAAACTTGGGAGAATATACTGGAA AAACACTGGCAACCAGGAAGATAG
AA sequence Show only first row Show all	>Lus10014630 pacid=23149640 polypeptide=Lus10014630 locus=Lus10014630.g ID=Lus10014630.BGIv1.0 annot-version=v1.0 MSDPNSVVLVHCKSRDNDLGIHNITGDVPYEFRFKPELIKATLFWCYVAPSNDRHAAFDAYSNMAHYREYDKKTYWVILDDGVYLSNRNEDGKTWENILE KHWQPGR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G38435		SPH8	S-protein homologue 8 (.1)		Lus10014630 [exp]	0	1

Compare expression of checked genes

Lus10014630 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.