Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33840 57 / 5e-11 Glycosyl hydrolase family 10 protein (.1) AT4G33830 56 / 1e-10 Glycosyl hydrolase family 10 protein (.1) AT4G33860 55 / 2e-10 Glycosyl hydrolase family 10 protein (.1) AT4G33810 50 / 1e-08 Glycosyl hydrolase superfamily protein (.1) AT4G33820 48 / 6e-08 Glycosyl hydrolase superfamily protein (.1) AT2G14690 47 / 7e-08 Glycosyl hydrolase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033784 [exp] 62 / 6e-13 AT4G33820 480 / 2e-160 Glycosyl hydrolase superfamily protein (.1) Lus10014642 [exp] 59 / 7e-12 AT4G33840 663 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10033786 [exp] 56 / 8e-11 AT4G33860 663 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10020985 [exp] 53 / 1e-09 AT4G33840 634 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10014647 [exp] 50 / 1e-09 AT4G33820 62 / 7e-13 Glycosyl hydrolase superfamily protein (.1) Lus10025054 [exp] 39 / 6e-05 AT4G38650 677 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10034490 [exp] 39 / 7e-05 AT4G38650 566 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G087800 [exp] 73 / 7e-17 AT4G33840 573 / 0.0 Glycosyl hydrolase family 10 protein (.1) Potri.009G087700 [exp] 70 / 8e-16 AT4G33860 529 / 0.0 Glycosyl hydrolase family 10 protein (.1) Potri.009G087600 [exp] 57 / 2e-11 AT4G33820 506 / 4e-175 Glycosyl hydrolase superfamily protein (.1) Potri.009G087900 [exp] 52 / 2e-09 AT4G33840 695 / 0.0 Glycosyl hydrolase family 10 protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014645 pacid=23149635 polypeptide=Lus10014645 locus=Lus10014645.g ID=Lus10014645.BGIv1.0 annot-version=v1.0 ATGGATTTCAAGAACACCGCTACTGGAGATGTTGTGGATAAGCTGATTGAAGAGTGGGGATCCACCACTTCCATTCTTGAATCAGATGAGAAAGGACTCA CAGAAATTTCATTGTTCCATGGAGATTACACCGTAACTGTTGAAAACACAGACACCACCAATTCCTTCAACTACAGAGTCTCAAAAGATGCTGCAGGAGG AGACAGTCTCCATGTTCGTTAA
AA sequence Show only first row Show all	>Lus10014645 pacid=23149635 polypeptide=Lus10014645 locus=Lus10014645.g ID=Lus10014645.BGIv1.0 annot-version=v1.0 MDFKNTATGDVVDKLIEEWGSTTSILESDEKGLTEISLFHGDYTVTVENTDTTNSFNYRVSKDAAGGDSLHVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33830			Glycosyl hydrolase family 10 p...		Lus10014645 [exp]	0	1
AT4G02050		STP7	sugar transporter protein 7 (....		Lus10021723 [exp]	11.4	0.6718
AT1G23540		IGI1, AtPERK12	proline-rich extensin-like rec...		Lus10029151 [exp]	24.4	0.5888
AT2G14830			Regulator of Vps4 activity in ...		Lus10018577 [exp]	32.1	0.6202
AT5G42905			Polynucleotidyl transferase, r...		Lus10006008 [exp]	35.8	0.6514
					Lus10041324 [exp]	45.5	0.6254
AT2G03370			Glycosyltransferase family 61 ...		Lus10037123 [exp]	71.2	0.6377
AT1G72940			Toll-Interleukin-Resistance (T...		Lus10041605 [exp]	76.7	0.6436
AT4G04750			Major facilitator superfamily ...		Lus10018957 [exp]	77.2	0.6361
					Lus10022170 [exp]	117.2	0.5596
AT3G20800			Cell differentiation, Rcd1-lik...		Lus10015136 [exp]	152.2	0.5902

Compare expression of checked genes

Lus10014645 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.