Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33810 61 / 1e-12 Glycosyl hydrolase superfamily protein (.1) AT4G33820 61 / 2e-12 Glycosyl hydrolase superfamily protein (.1) AT4G33860 60 / 3e-12 Glycosyl hydrolase family 10 protein (.1) AT2G14690 60 / 5e-12 Glycosyl hydrolase superfamily protein (.1) AT4G33840 54 / 4e-10 Glycosyl hydrolase family 10 protein (.1) AT4G33830 54 / 4e-10 Glycosyl hydrolase family 10 protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033784 [exp] 152 / 9e-45 AT4G33820 480 / 2e-160 Glycosyl hydrolase superfamily protein (.1) Lus10014642 [exp] 55 / 3e-10 AT4G33840 663 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10033786 [exp] 54 / 6e-10 AT4G33860 663 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10014645 [exp] 50 / 1e-09 AT4G33830 56 / 7e-11 Glycosyl hydrolase family 10 protein (.1) Lus10020985 [exp] 44 / 3e-06 AT4G33840 634 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10034490 [exp] 38 / 0.0002 AT4G38650 566 / 0.0 Glycosyl hydrolase family 10 protein (.1) Lus10025054 [exp] 38 / 0.0003 AT4G38650 677 / 0.0 Glycosyl hydrolase family 10 protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.009G087700 [exp] 92 / 2e-23 AT4G33860 529 / 0.0 Glycosyl hydrolase family 10 protein (.1) Potri.009G087600 [exp] 81 / 1e-19 AT4G33820 506 / 4e-175 Glycosyl hydrolase superfamily protein (.1) Potri.009G087800 [exp] 81 / 2e-19 AT4G33840 573 / 0.0 Glycosyl hydrolase family 10 protein (.1) Potri.009G087900 [exp] 47 / 9e-08 AT4G33840 695 / 0.0 Glycosyl hydrolase family 10 protein (.1) Potri.004G173300 [exp] 37 / 0.0006 AT4G38650 753 / 0.0 Glycosyl hydrolase family 10 protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014647 pacid=23149624 polypeptide=Lus10014647 locus=Lus10014647.g ID=Lus10014647.BGIv1.0 annot-version=v1.0 ATGTTTGCTGGACCGGAATCAGCCGGTTTCAAAGAATTAACCCTGGCAGACAGAGACTTCGGGAATACTGCAGCTGGAGATGTGGTGGATAAGCTGCTCA ATGAGAGGAAAAGTGATGGTGATGTAGCTTATGCAGCAGAGGGGGAGGGTTTCGTACAGGCTTCGTTGTTTTACGGGGATTACGAGATAAGTATTCGAAA TCCGGAAACCAATTCTGTCACTAGTTTGAGTTACAAGCACTGA
AA sequence Show only first row Show all	>Lus10014647 pacid=23149624 polypeptide=Lus10014647 locus=Lus10014647.g ID=Lus10014647.BGIv1.0 annot-version=v1.0 MFAGPESAGFKELTLADRDFGNTAAGDVVDKLLNERKSDGDVAYAAEGEGFVQASLFYGDYEISIRNPETNSVTSLSYKH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33820			Glycosyl hydrolase superfamily...		Lus10014647 [exp]	0	1
AT4G33820			Glycosyl hydrolase superfamily...		Lus10014646 [exp]	6.7	0.8357
AT1G09480			NAD(P)-binding Rossmann-fold s...		Lus10019734 [exp]	11.0	0.7676
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	16.6	0.7984
AT5G42905			Polynucleotidyl transferase, r...		Lus10006008 [exp]	23.2	0.7475
AT4G37990		CAD-B2, ATCAD8,...	CINNAMYL-ALCOHOL DEHYDROGENASE...		Lus10038536 [exp]	34.8	0.7880
AT1G18530			EF hand calcium-binding protei...		Lus10039961 [exp]	45.3	0.7639
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	50.7	0.7460
AT4G18050		ABCB9, PGP9	ATP-binding cassette B9, P-gly...		Lus10004583 [exp]	70.7	0.7311
AT1G52690		LEA7	LATE EMBRYOGENESIS ABUNDANT 7,...		Lus10007956 [exp]	81.2	0.7391
AT4G04750			Major facilitator superfamily ...		Lus10018957 [exp]	107.1	0.7111

Compare expression of checked genes

Lus10014647 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.