Lus10014692 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10014692 pacid=23165584 polypeptide=Lus10014692 locus=Lus10014692.g ID=Lus10014692.BGIv1.0 annot-version=v1.0
ATGAAGGAAGCCGGAAATGATCGGAAAACCAGCGCCGGGGGTCGGGGGAGAGGAAAAAAGCATCCAGAAGGACGCCCTCCGGCAACAGTGCGAACGTCGC
CGGCCAAAGAAGAGGGGGAGACGGTTGTGCGAGAAAAGATTGACGACAACGGCCGTGCGAGACGATTCATGGTTAATGCGGAGAATACGACAATGATGCA
AATGCAAGGGTAG
AA sequence
>Lus10014692 pacid=23165584 polypeptide=Lus10014692 locus=Lus10014692.g ID=Lus10014692.BGIv1.0 annot-version=v1.0
MKEAGNDRKTSAGGRGRGKKHPEGRPPATVRTSPAKEEGETVVREKIDDNGRARRFMVNAENTTMMQMQG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10014692 0 1
Lus10017551 1.4 0.9677
AT1G73120 unknown protein Lus10022961 2.4 0.9594
AT5G55590 QRT1 QUARTET 1, Pectin lyase-like s... Lus10016605 5.5 0.9179
AT1G54460 TPX2 (targeting protein for Xk... Lus10042543 13.0 0.8643
Lus10042586 14.0 0.9051
AT4G08910 unknown protein Lus10025524 21.5 0.8347
Lus10021217 22.1 0.9300
Lus10027902 23.7 0.9230
AT3G07020 UGT80A2, SGT UDP-glucosyl transferase 80A2,... Lus10009556 25.1 0.9156
AT1G40087 Plant transposase (Ptta/En/Spm... Lus10007402 29.6 0.8634

Lus10014692 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.