Lus10014704 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G63300 108 / 5e-28 FKD1 FORKED 1 (.1.2)
AT3G22810 74 / 1e-15 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
AT5G43870 54 / 9e-09 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
AT4G14740 54 / 1e-08 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
AT4G17350 46 / 5e-06 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
AT5G47440 45 / 7e-06 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10004079 172 / 2e-53 AT3G63300 167 / 2e-47 FORKED 1 (.1.2)
Lus10039370 79 / 1e-17 AT4G14740 219 / 2e-69 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Lus10006614 79 / 1e-17 AT4G14740 504 / 5e-177 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Lus10041187 71 / 1e-14 AT4G14740 315 / 1e-103 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Lus10021903 61 / 2e-11 AT5G43870 159 / 8e-47 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Lus10004734 42 / 0.0002 AT4G17350 389 / 2e-133 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G213800 114 / 4e-30 AT3G63300 388 / 7e-131 FORKED 1 (.1.2)
Potri.002G049200 112 / 3e-29 AT3G63300 418 / 1e-142 FORKED 1 (.1.2)
Potri.010G082400 76 / 2e-16 AT4G14740 468 / 1e-162 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region
Potri.008G157000 74 / 1e-15 AT3G22810 430 / 9e-148 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Potri.003G077900 47 / 3e-06 AT4G17350 356 / 4e-121 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Potri.001G156700 46 / 5e-06 AT4G17350 348 / 8e-118 Plant protein of unknown function (DUF828) with plant pleckstrin homology-like region (.1)
Potri.018G042000 41 / 0.0002 AT4G32785 159 / 1e-47 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05703 Auxin_canalis Auxin canalisation
Representative CDS sequence
>Lus10014704 pacid=23165567 polypeptide=Lus10014704 locus=Lus10014704.g ID=Lus10014704.BGIv1.0 annot-version=v1.0
ATGGAAGAAACCCCTTTAATCAGACCAACCCACCACTTCCCCACCACCACACCCACAGCCATGATTCCTCTGCCAGAGTCCCCAAAACTACCCATGGAAT
TCCTCTCAAGATCCTGGAGCGTCTCTGCCCTCCAAGTCTCCAAAGCCTTAGTCTCCAACTGCTTATCTTCTTCCATCTCCACCAACTCCCTTTCCTCCTC
CTCTTCTTCCACCATCCCTGAAGAACTCGCCACTCCTCCCGCCGAACTCTCCCAGCCCAACAACAATCAGTTCTCCTTCGCTTCCTCTGCCAGCTCCCAG
CTTGTTCTTGAGCGCATCATGTCCCAGTCCGAAGTTTCGCCATTGACGTCAGGCAGGCTTTCTCACAGCAGCGGACCTTTGAACTTCGGCGAACCAGATA
GCCCTCCTCAAACTCTTTCGCCCTCTGACGACTTCGAAGACGTCGTTAAGAGTGTTTCGTGGTCTTGTCTTGTCTTGTCTGCCAAAGGTTTGACGATGGG
TATACTCTGTTTTGATCACCTTCATGATTAA
AA sequence
>Lus10014704 pacid=23165567 polypeptide=Lus10014704 locus=Lus10014704.g ID=Lus10014704.BGIv1.0 annot-version=v1.0
MEETPLIRPTHHFPTTTPTAMIPLPESPKLPMEFLSRSWSVSALQVSKALVSNCLSSSISTNSLSSSSSSTIPEELATPPAELSQPNNNQFSFASSASSQ
LVLERIMSQSEVSPLTSGRLSHSSGPLNFGEPDSPPQTLSPSDDFEDVVKSVSWSCLVLSAKGLTMGILCFDHLHD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G63300 FKD1 FORKED 1 (.1.2) Lus10014704 0 1
AT1G21740 Protein of unknown function (D... Lus10024007 1.0 0.9721
AT3G22810 Plant protein of unknown funct... Lus10014703 6.0 0.9555
AT1G68480 C2H2ZnF JAG JAGGED, C2H2 and C2HC zinc fin... Lus10041443 6.0 0.9699
AT4G03270 CYCD6;1 Cyclin D6;1 (.1) Lus10039738 7.7 0.9596
AT3G02645 Plant protein of unknown funct... Lus10031159 8.5 0.9620
AT2G02540 ZF_HD ATHB21, ZFHD4, ... ZINC FINGER HOMEODOMAIN 3, ZIN... Lus10038135 8.8 0.9643
AT2G35640 Trihelix Homeodomain-like superfamily p... Lus10040628 10.7 0.9571
AT1G11600 CYP77B1 "cytochrome P450, family 77, s... Lus10007660 13.7 0.9474
AT5G51560 Leucine-rich repeat protein ki... Lus10031703 14.1 0.9505
AT2G35640 Trihelix Homeodomain-like superfamily p... Lus10018283 15.0 0.9558

Lus10014704 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.