Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G63420 103 / 3e-30 AGG1, ATAGG1 Ggamma-subunit 1 (.1.2) AT3G22942 96 / 4e-27 AtGG2, AGG2 G-protein gamma subunit 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003092 [exp] 183 / 1e-61 AT3G63420 103 / 2e-30 Ggamma-subunit 1 (.1.2) Lus10029687 [exp] 70 / 4e-16 AT3G63420 69 / 4e-16 Ggamma-subunit 1 (.1.2) Lus10042727 [exp] 69 / 7e-16 AT3G63420 70 / 3e-16 Ggamma-subunit 1 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G046900 [exp] 130 / 8e-41 AT3G63420 102 / 1e-29 Ggamma-subunit 1 (.1.2) Potri.005G216100 [exp] 124 / 3e-38 AT3G63420 103 / 4e-30 Ggamma-subunit 1 (.1.2) Potri.015G142500 [exp] 122 / 2e-37 AT3G22942 100 / 4e-29 G-protein gamma subunit 2 (.1) Potri.005G179600 [exp] 81 / 9e-21 AT3G63420 81 / 3e-21 Ggamma-subunit 1 (.1.2) Potri.002G081500 [exp] 74 / 3e-18 AT3G63420 62 / 1e-13 Ggamma-subunit 1 (.1.2) Potri.018G062400 [exp] 37 / 0.0009 AT5G20635 112 / 3e-30 Arabidopsis G protein gamma subunit 3, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014714 pacid=23165634 polypeptide=Lus10014714 locus=Lus10014714.g ID=Lus10014714.BGIv1.0 annot-version=v1.0 ATGGATTCCGAACCCACGTCGTCCGTGGACGAGGAGGCTCTCGTCGCAGGAACTCTCGCAGCTGGCGTCGCCGTCGGAGCAGCTGATACGAGAGGGAAAC ATCGGATTCTTGCCGAGCTCAAGCGGATCGAGCAAGAAATCAGCTTTCTTGAGAGGGAACTAGATGAACTTGACAAAACAGACAATGTATCGACTGTATG TGAAGGATTCTTACGCAATGTGGAGACGATACCAGATCCACTGCTCTCAATAACGATTGGTCCTGCTAACCCGATATGGGACCGATGGTTCGAGGGTACT CCAGATGCTGGCGGCTGCAGCTGTACCATACTCTGA
AA sequence Show only first row Show all	>Lus10014714 pacid=23165634 polypeptide=Lus10014714 locus=Lus10014714.g ID=Lus10014714.BGIv1.0 annot-version=v1.0 MDSEPTSSVDEEALVAGTLAAGVAVGAADTRGKHRILAELKRIEQEISFLERELDELDKTDNVSTVCEGFLRNVETIPDPLLSITIGPANPIWDRWFEGT PDAGGCSCTIL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G63420		AGG1, ATAGG1	Ggamma-subunit 1 (.1.2)		Lus10014714 [exp]	0	1
AT5G61830			NAD(P)-binding Rossmann-fold s...		Lus10001968 [exp]	7.7	0.9047
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10004670 [exp]	9.0	0.9058
AT5G05320			FAD/NAD(P)-binding oxidoreduct...		Lus10025068 [exp]	15.0	0.8954
					Lus10002087 [exp]	16.6	0.8930
AT3G11660		NHL1	NDR1/HIN1-like 1 (.1)		Lus10029406 [exp]	16.7	0.8936
AT5G39820	NAC	ANAC094	NAC domain containing protein ...		Lus10037178 [exp]	18.5	0.8887
AT5G46060			Protein of unknown function, D...		Lus10000133 [exp]	18.8	0.8312
AT4G23430		AtTic32-IVa	translocon at the inner envelo...		Lus10032282 [exp]	22.6	0.8921
AT4G06536			SPla/RYanodine receptor (SPRY)...		Lus10010045 [exp]	24.3	0.8879
AT3G07570			Cytochrome b561/ferric reducta...		Lus10016080 [exp]	28.8	0.8846

Compare expression of checked genes

Lus10014714 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.