Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014719 pacid=23165579 polypeptide=Lus10014719 locus=Lus10014719.g ID=Lus10014719.BGIv1.0 annot-version=v1.0 ATGGAGGGCAATAAACTAGCGGTTGCTTGCTTTTGTCGTTTGTGCCATGGCTCAGCAGGAAGTAGGGTTCCGATAGAATCTTGGGACTTGTACCAGGAAG GTAAAGGACTGAGGAGTGGTCTTCCACCATATGAGAAGATCAAAGCCAAGTGTCGGTTGGGAAGAACCAGGACTATGTATATGGTCACTCAGGTTGTGGC CGTCTGA
AA sequence Show only first row Show all	>Lus10014719 pacid=23165579 polypeptide=Lus10014719 locus=Lus10014719.g ID=Lus10014719.BGIv1.0 annot-version=v1.0 MEGNKLAVACFCRLCHGSAGSRVPIESWDLYQEGKGLRSGLPPYEKIKAKCRLGRTRTMYMVTQVVAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014719 [exp]	0	1
AT1G31710			Copper amine oxidase family pr...		Lus10010540 [exp]	1.0	0.9896
AT5G50230			Transducin/WD40 repeat-like su...		Lus10015925 [exp]	1.7	0.9833
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10019637 [exp]	3.2	0.9835
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Lus10040975 [exp]	3.9	0.9797
					Lus10024084 [exp]	4.2	0.9727
AT1G15260			unknown protein		Lus10035880 [exp]	4.2	0.9794
AT4G12310		CYP706A5	"cytochrome P450, family 706, ...		Lus10032210 [exp]	4.6	0.9765
AT4G37070		AtPLAIVA, PLP1,...	phospholipase A IVA, Acyl tran...		Lus10000279 [exp]	4.9	0.9831
AT5G64440		ATFAAH	fatty acid amide hydrolase (.1...		Lus10016685 [exp]	5.1	0.9585
AT1G15260			unknown protein		Lus10011448 [exp]	6.0	0.9652

Compare expression of checked genes

Lus10014719 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.