Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G04240 231 / 2e-77 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT5G43700 230 / 2e-77 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT3G23030 191 / 5e-62 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT4G14560 189 / 2e-61 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1) AT1G04250 182 / 1e-57 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT3G04730 175 / 5e-55 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT3G23050 171 / 3e-53 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT4G14550 167 / 6e-52 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT4G29080 162 / 2e-49 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT3G15540 147 / 8e-45 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002723 [exp] 394 / 9e-142 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10018764 [exp] 285 / 2e-98 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10024853 [exp] 282 / 2e-97 AT1G04240 216 / 1e-71 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 236 / 1e-79 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 236 / 2e-79 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10028222 [exp] 182 / 2e-57 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10039414 [exp] 174 / 2e-54 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10042929 [exp] 162 / 3e-48 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 158 / 1e-47 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218200 [exp] 257 / 7e-88 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 254 / 2e-86 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041300 [exp] 253 / 5e-86 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 250 / 4e-85 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G078400 [exp] 225 / 3e-75 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 223 / 5e-74 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161200 [exp] 174 / 1e-54 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 171 / 3e-53 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.002G044900 [exp] 167 / 1e-51 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.001G177400 [exp] 163 / 2e-50 AT3G04730 211 / 8e-69 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10014729 pacid=23165629 polypeptide=Lus10014729 locus=Lus10014729.g ID=Lus10014729.BGIv1.0 annot-version=v1.0 ATGGAGAGCCGCTCATCACCGATGCAGTTGGACTCCGATCTGAATCTCAAAGCTACAGAGCTCAGACTAGGCTTACCGGGGAGCGACGAGTCAACCACCA CTTGTCCATCATCAACTCTACTTCAAATCAGCATCAATAATAACAACAAGAGATCTTCGCCGGAAGCATCGTCCGTCGACGAGAGCAGGTCGCAGAGCAA TTCCACCGCTTCCAACGTTGACCGACATTCTATCCCCCCTCCCGCCAAAGCGCAAATAGTCGGATGGCCGCCGGTGCGTTCGTACAGGAAGAGCTGCTTA CAGCAGAAGAAAATCGATCCTTCTTCTAATTCCGCGGGGATGTTTGTGAAAGTAAGCATGGACGGAGCTGCATATCTCCGGAAGATCGACGTGAAGATGT ATAAGAGCTACGAAGAGCTTCTGACCGGGTTGGAGGAGATGTTCAAGCTGAGATTCGGTCAGTACTCAGAGAGAGAAGGATACAACGGATCTGACTTTGC TCCGACTTACCAAGACAAAGACGGTGATTGGATGCTGGTCGGCGATGTTCCGTGGGAGATGTTCATCAACTCTTGCAAAAGGCTTAGGATAATCAAAGGA TCCGAAGCCAGAGGGCTCGGCTGTTTATGA
AA sequence Show only first row Show all	>Lus10014729 pacid=23165629 polypeptide=Lus10014729 locus=Lus10014729.g ID=Lus10014729.BGIv1.0 annot-version=v1.0 MESRSSPMQLDSDLNLKATELRLGLPGSDESTTTCPSSTLLQISINNNNKRSSPEASSVDESRSQSNSTASNVDRHSIPPPAKAQIVGWPPVRSYRKSCL QQKKIDPSSNSAGMFVKVSMDGAAYLRKIDVKMYKSYEELLTGLEEMFKLRFGQYSEREGYNGSDFAPTYQDKDGDWMLVGDVPWEMFINSCKRLRIIKG SEARGLGCL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10014729 [exp]	0	1
AT5G35090			unknown protein		Lus10001931 [exp]	2.0	0.8817
AT1G10350			DNAJ heat shock family protein...		Lus10013280 [exp]	5.1	0.8723
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10002723 [exp]	5.5	0.8488
AT4G00880			SAUR-like auxin-responsive pro...		Lus10032949 [exp]	8.7	0.8608
AT3G21570			unknown protein		Lus10034002 [exp]	9.6	0.8607
AT5G66200		ARO2	armadillo repeat only 2 (.1)		Lus10041905 [exp]	11.2	0.8279
AT2G17230		EXL5	EXORDIUM like 5 (.1)		Lus10013834 [exp]	19.7	0.8172
AT4G37260	MYB	ATMYB73	myb domain protein 73 (.1)		Lus10010055 [exp]	20.7	0.8195
AT4G22120			ERD (early-responsive to dehyd...		Lus10020032 [exp]	20.7	0.7843
AT3G21570			unknown protein		Lus10012773 [exp]	23.0	0.8187

Compare expression of checked genes

Lus10014729 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.