Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G24490 49 / 5e-08 Trihelix Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019568 [exp] 84 / 1e-22 AT3G24490 50 / 8e-09 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10019388 [exp] 72 / 7e-16 AT3G24490 200 / 2e-60 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10043246 [exp] 54 / 4e-10 ND / Lus10033094 [exp] 50 / 2e-08 AT3G24490 238 / 6e-76 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10017725 [exp] 50 / 2e-08 AT3G24490 243 / 1e-77 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10025772 [exp] 47 / 4e-07 AT3G24490 223 / 3e-70 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Lus10035893 [exp] 43 / 8e-06 AT3G24490 214 / 1e-66 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G075500 [exp] 49 / 4e-08 AT3G24490 252 / 1e-81 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.003G056000 [exp] 45 / 2e-06 AT3G24490 205 / 8e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1) Potri.001G179800 [exp] 44 / 3e-06 AT3G24490 206 / 2e-63 Alcohol dehydrogenase transcription factor Myb/SANT-like family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014730 pacid=23165640 polypeptide=Lus10014730 locus=Lus10014730.g ID=Lus10014730.BGIv1.0 annot-version=v1.0 ATGACGAGCACTAAGAAGGAACAGATGTTGGAGTTGGAGATGATGCGGGTTGATTTCCATGCGGGATTGGCGTTGCAGAGGAAGCAAATCTTGGAGATAA CTCTGGGCGAGATTGCTAAAATCAGAGATGAGGATGATGTTGATAATGACCCTAAAAGCAATGTCAATAAAGAAAGAAAAGCTGAGGATGAGAGTGGTGA TGATGACGATTCCGGGGGAATGTCAGCAAACAATGTGAGTAATGTTTGGATACGATGGATGTTCAAGTGTTGTATAGTAGCACAGCATCAAGTTTCGAAA CTTTACCGTTAG
AA sequence Show only first row Show all	>Lus10014730 pacid=23165640 polypeptide=Lus10014730 locus=Lus10014730.g ID=Lus10014730.BGIv1.0 annot-version=v1.0 MTSTKKEQMLELEMMRVDFHAGLALQRKQILEITLGEIAKIRDEDDVDNDPKSNVNKERKAEDESGDDDDSGGMSANNVSNVWIRWMFKCCIVAQHQVSK LYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G24490	Trihelix		Alcohol dehydrogenase transcri...		Lus10014730 [exp]	0	1
					Lus10007903 [exp]	1.4	0.8849
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10011662 [exp]	9.2	0.8823
AT1G24340		EMB260, EMB2421	EMBRYO DEFECTIVE 260, EMBRYO D...		Lus10006431 [exp]	9.9	0.6681
AT4G31880			unknown protein		Lus10002307 [exp]	12.1	0.8770
AT4G30200		VEL1, VIL2	VIN3-Like 2, vernalization5/VI...		Lus10040339 [exp]	13.2	0.8053
AT1G33530			F-box family protein (.1)		Lus10014984 [exp]	14.1	0.8652
AT4G19170		CCD4, NCED4	carotenoid cleavage dioxygenas...		Lus10035700 [exp]	16.0	0.8583
AT4G01310			Ribosomal L5P family protein (...		Lus10033169 [exp]	16.1	0.7978
AT5G51280			DEAD-box protein abstrakt, put...		Lus10012900 [exp]	17.8	0.8558
AT1G74670		GASA6	GA-stimulated Arabidopsis 6, G...		Lus10024216 [exp]	21.8	0.8474

Compare expression of checked genes

Lus10014730 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.