Lus10014733 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02300 99 / 6e-25 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT2G26450 97 / 3e-24 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT1G53830 95 / 2e-23 ATPME2 pectin methylesterase 2 (.1)
AT2G45220 95 / 2e-23 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT3G14310 95 / 2e-23 ATPME3 pectin methylesterase 3 (.1)
AT1G11580 94 / 3e-23 ATPMEPCRA methylesterase PCR A (.1)
AT4G33230 94 / 3e-23 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02320 94 / 6e-23 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT4G02330 94 / 6e-23 AtPME41, ATPMEPCRB pectin methylesterase 41, Plant invertase/pectin methylesterase inhibitor superfamily (.1)
AT5G53370 87 / 1e-20 ATPMEPCRF pectin methylesterase PCR fragment F (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008203 142 / 1e-40 AT4G02320 497 / 2e-172 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10006103 100 / 2e-25 AT2G45220 592 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10027202 100 / 3e-25 AT2G45220 620 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10038917 99 / 6e-25 AT2G45220 630 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10028536 92 / 7e-24 AT3G60730 322 / 6e-109 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10018103 96 / 2e-23 AT3G49220 799 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10039314 94 / 6e-23 AT3G14310 702 / 0.0 pectin methylesterase 3 (.1)
Lus10009110 91 / 6e-22 AT1G23200 501 / 1e-173 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Lus10010170 87 / 2e-20 AT3G43270 628 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G202500 119 / 4e-32 AT4G02320 576 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.015G127700 108 / 3e-28 AT2G45220 680 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.003G072800 103 / 1e-26 AT3G14310 795 / 0.0 pectin methylesterase 3 (.1)
Potri.012G126800 101 / 9e-26 AT2G45220 637 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.012G014500 100 / 2e-25 AT3G49220 789 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.002G145500 100 / 3e-25 AT2G45220 670 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.001G162600 97 / 5e-24 AT3G14310 551 / 0.0 pectin methylesterase 3 (.1)
Potri.011G025400 96 / 1e-23 AT1G11580 638 / 0.0 methylesterase PCR A (.1)
Potri.015G013700 96 / 1e-23 AT3G49220 805 / 0.0 Plant invertase/pectin methylesterase inhibitor superfamily (.1)
Potri.018G051400 96 / 1e-23 AT3G14310 708 / 0.0 pectin methylesterase 3 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0268 Pec_lyase-like PF01095 Pectinesterase Pectinesterase
Representative CDS sequence
>Lus10014733 pacid=23165623 polypeptide=Lus10014733 locus=Lus10014733.g ID=Lus10014733.BGIv1.0 annot-version=v1.0
ATGTTCGTCGGCGATGGGATCGGCAAGGTCAAGGCCAACAAAACCTCGTCGATGGACGGCCCACTTTCCATTCCGCAACTGTGGGGAGGACCGAAAGAAA
AAATTGGCATTGTTCTCCACAACTGTAAGTTTGCAGCCGCCACTGACCTTATCCCGGTCAAGATCCAGTTCAAGACTTACTTGGGCCGGCCCTGGAAGGC
ATATTCGATGACTGCCATTGTGGGCTCGTACATAGATGACGTGGTGGACCCCGCAAGGTGGCTCGAGTGTGACGATTCAGGGGCAAGTTCGAATACCACT
CAGAGAGTGCCATGGTCGGGTTATCGGGTTATTAAGAGTTCAATTGAGGCGAATAGGTTTACGTTTGGGCAGTTTATTCAGGGAGTTAGCGGCTCAATAC
CACTGATATACCTTTCACTTCCGGTTTACGTTTGA
AA sequence
>Lus10014733 pacid=23165623 polypeptide=Lus10014733 locus=Lus10014733.g ID=Lus10014733.BGIv1.0 annot-version=v1.0
MFVGDGIGKVKANKTSSMDGPLSIPQLWGGPKEKIGIVLHNCKFAAATDLIPVKIQFKTYLGRPWKAYSMTAIVGSYIDDVVDPARWLECDDSGASSNTT
QRVPWSGYRVIKSSIEANRFTFGQFIQGVSGSIPLIYLSLPVYV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02300 Plant invertase/pectin methyle... Lus10014733 0 1

Lus10014733 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.