Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 77 / 1e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT3G46860 66 / 5e-16 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43580 66 / 8e-16 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 58 / 1e-12 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38900 54 / 1e-11 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002732 [exp] 105 / 8e-32 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018786 [exp] 94 / 3e-27 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10024870 [exp] 94 / 4e-27 AT2G38870 94 / 2e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018784 [exp] 83 / 5e-23 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018783 [exp] 79 / 3e-21 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10043097 [exp] 66 / 2e-14 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10032655 [exp] 66 / 4e-14 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10010859 [exp] 41 / 4e-06 AT2G38900 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) Lus10024370 [exp] 40 / 9e-06 AT2G38870 47 / 3e-08 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G042300 [exp] 94 / 2e-27 AT2G38870 68 / 5e-17 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075400 [exp] 86 / 6e-24 AT2G38870 84 / 3e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 84 / 1e-23 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.009G028300 [exp] 83 / 5e-23 AT5G43580 76 / 7e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075501 [exp] 82 / 2e-22 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075300 [exp] 82 / 2e-22 AT5G43580 77 / 2e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 82 / 2e-22 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075800 [exp] 78 / 5e-21 AT2G38870 76 / 3e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110100 [exp] 74 / 3e-19 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.011G110400 [exp] 73 / 7e-19 AT5G43580 78 / 1e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10014740 pacid=23165648 polypeptide=Lus10014740 locus=Lus10014740.g ID=Lus10014740.BGIv1.0 annot-version=v1.0 ATGTCCCGACGGTGTCCAGGTAAGAATGCGTGGCCGGAGCTGGTGGGGAAGAGCGGAAATATGGCGGCGGCGACGGTCGAAAGAGAAAACAGAAACGTGC ACGCAATCGTCTTAAAGGAAGGAAGCGCGATGACGAAGGACTTCAGGTGCGATAGGGTGTGGGTTATAGTGAATGACCATGGCGTCGTCACTTCCGTTCC CCACATCACCTGA
AA sequence Show only first row Show all	>Lus10014740 pacid=23165648 polypeptide=Lus10014740 locus=Lus10014740.g ID=Lus10014740.BGIv1.0 annot-version=v1.0 MSRRCPGKNAWPELVGKSGNMAAATVERENRNVHAIVLKEGSAMTKDFRCDRVWVIVNDHGVVTSVPHIT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38870			Serine protease inhibitor, pot...		Lus10014740 [exp]	0	1
AT4G25810		XTH23, XTR6	xyloglucan endotransglucosylas...		Lus10030484 [exp]	1.0	0.9558
AT3G61490			Pectin lyase-like superfamily ...		Lus10036383 [exp]	2.8	0.9178
AT3G21360			2-oxoglutarate (2OG) and Fe(II...		Lus10038282 [exp]	3.0	0.9195
					Lus10015218 [exp]	4.5	0.9288
AT2G36780			UDP-Glycosyltransferase superf...		Lus10014402 [exp]	5.5	0.8730
AT1G68040			S-adenosyl-L-methionine-depend...		Lus10013484 [exp]	5.7	0.8084
					Lus10026796 [exp]	7.4	0.8583
AT3G12620			Protein phosphatase 2C family ...		Lus10003993 [exp]	7.5	0.8715
AT3G23150		ETR2	ethylene response 2, Signal tr...		Lus10021880 [exp]	8.4	0.8613
AT2G29640		JOSL	JOSEPHIN-like protein (.1)		Lus10040691 [exp]	8.5	0.8696

Compare expression of checked genes

Lus10014740 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.