Lus10014746 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49142 223 / 7e-69 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G11460 219 / 6e-68 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G13410 215 / 1e-67 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT3G49170 220 / 8e-67 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G21300 219 / 3e-66 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G56310 210 / 4e-65 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT4G14820 209 / 2e-63 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G26782 207 / 3e-63 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G02750 209 / 5e-63 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT4G19191 206 / 8e-63 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033858 459 / 1e-161 AT1G08070 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10031989 224 / 3e-69 AT3G26782 865 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10014211 222 / 8e-69 AT3G11460 791 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10022702 219 / 2e-68 AT3G11460 641 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10031028 213 / 3e-65 AT4G19191 727 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021069 209 / 6e-65 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10021068 209 / 6e-65 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Lus10030225 205 / 7e-65 AT5G08510 472 / 2e-165 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10009269 211 / 1e-64 AT2G13600 874 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G121400 233 / 9e-74 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G211400 229 / 8e-72 AT3G11460 772 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.001G322100 226 / 3e-70 AT3G26782 897 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.001G369900 216 / 8e-67 AT5G66520 512 / 2e-175 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.009G044700 217 / 3e-66 AT2G29760 1013 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.006G105700 216 / 4e-66 AT3G08820 810 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.018G035900 212 / 7e-66 AT2G20540 709 / 0.0 mitochondrial editing factor 21 (.1)
Potri.016G128900 214 / 2e-65 AT3G08820 812 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Potri.013G103600 212 / 5e-65 AT1G08070 477 / 7e-160 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.016G077700 210 / 2e-64 AT4G30700 489 / 1e-164 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10014746 pacid=23165637 polypeptide=Lus10014746 locus=Lus10014746.g ID=Lus10014746.BGIv1.0 annot-version=v1.0
ATGTACGCAAAGTGCGGAAACATAGGCCAGGCAGAGGATGTTTTCAAGAATTTGACAGAAAAAACAGTTGTGTCCTGGACTTCAATTATCGGGGCTTTGG
CGTACCATGGCCGTGCAATCGAAGCTCTTGAGCTCTTCGCGCAGATGAAAGAAGAGGGCACCAGACCGAATGGCTTCACATTCACTGCTATCTTGACTGC
TTGTAAGCATGCAGGTCTTGTGGATGAGGGGAGGAAGCAATTTGAGAGTATGTTCAAGGAATACTCCATTGTTCCTGGAATCGAGCAGTGTGCTTGTATG
GTCGATCTCCTTGGGAGAGCTGGTTGTTTGACTGAGGCTTACGAATTCATCGAGAGCATGCCGATTCGGGCGGATCCAAGTGTGTGGGGTGCATTACTCG
GTGCTTGCAGAATTTATGAGGATTGCGAACTTGCTGAGCTTGTGGCAGAGAAGCTGATTAAGTTGGACCCTCGGGACATAACTCCTTACGTCATTATGTC
TCACATTTATTGTAATGCTGGCCGGTCGGAAGATGTATTGAGGTTAAGAAAGTTGATGAGAGAAAGGCAATTGAAGAAGTTACCTGGTCATAGTCTTGTC
GAGGCAAATCGTCGACTTCATAGGTTTCTAGTAGATTCAAGGCCCCGACCATCTTGGCCAGCTGTGTGA
AA sequence
>Lus10014746 pacid=23165637 polypeptide=Lus10014746 locus=Lus10014746.g ID=Lus10014746.BGIv1.0 annot-version=v1.0
MYAKCGNIGQAEDVFKNLTEKTVVSWTSIIGALAYHGRAIEALELFAQMKEEGTRPNGFTFTAILTACKHAGLVDEGRKQFESMFKEYSIVPGIEQCACM
VDLLGRAGCLTEAYEFIESMPIRADPSVWGALLGACRIYEDCELAELVAEKLIKLDPRDITPYVIMSHIYCNAGRSEDVLRLRKLMRERQLKKLPGHSLV
EANRRLHRFLVDSRPRPSWPAV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49142 Tetratricopeptide repeat (TPR)... Lus10014746 0 1
AT2G20020 CAF1, ATCAF1 RNA-binding CRS1 / YhbY (CRM) ... Lus10043237 2.0 0.7957
AT3G51250 Senescence/dehydration-associa... Lus10041892 3.5 0.7785
AT3G17670 tetratricopeptide repeat (TPR)... Lus10007446 5.5 0.7914
AT3G03550 RING/U-box superfamily protein... Lus10035677 9.5 0.7573
AT1G01040 SIN1, EMB76, EM... SHORT INTEGUMENTS 1, EMBRYO DE... Lus10005142 11.2 0.7780
AT5G46390 Peptidase S41 family protein (... Lus10004601 12.4 0.7895
AT4G10000 Thioredoxin family protein (.1... Lus10009466 17.7 0.7569
AT3G28860 ABCB19, ATMDR11... P-GLYCOPROTEIN 19, MULTIDRUG R... Lus10020905 18.5 0.7478
Lus10000429 23.0 0.7133
AT5G36230 ARM repeat superfamily protein... Lus10018182 23.0 0.7487

Lus10014746 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.