Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003842 [exp] 53 / 1e-09 AT1G48120 50 / 4e-07 hydrolases;protein serine/threonine phosphatases (.1) Lus10034854 [exp] 51 / 3e-09 AT1G48120 69 / 3e-14 hydrolases;protein serine/threonine phosphatases (.1) Lus10008569 [exp] 49 / 4e-08 AT1G48120 50 / 6e-07 hydrolases;protein serine/threonine phosphatases (.1) Lus10004097 [exp] 46 / 5e-07 AT1G48120 61 / 4e-10 hydrolases;protein serine/threonine phosphatases (.1) Lus10025297 [exp] 44 / 8e-07 ND 52 / 2e-08 Lus10029535 [exp] 44 / 1e-06 AT1G48120 50 / 1e-07 hydrolases;protein serine/threonine phosphatases (.1) Lus10003038 [exp] 44 / 3e-06 ND 61 / 7e-10 Lus10005532 [exp] 44 / 4e-06 ND 52 / 3e-07 Lus10009239 [exp] 43 / 4e-06 ND 44 / 3e-05
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014748 pacid=23165582 polypeptide=Lus10014748 locus=Lus10014748.g ID=Lus10014748.BGIv1.0 annot-version=v1.0 ATGGGAGAGTTGGATTTGCGTATGTGCCTGCCCAGTTACGGTGACCGAGTACCGGCATCTTCGACGAGGGCACACCATTCGAGCGTACAGTGGCACAGGC TAGACTGGGTGATGATGCAGATTGGGATGGCGGAGCCAATCCCGCAATGGGAGACTGGTGAGAGCGAGGCGATTGGCTTGCTTGAGATTATCCAGAGGAA CGATCGCCGAGCTGTGACCAGACTTTCCCACTACCGTTGGTTGTGGAAGATGAGGTTGGAGCACGTGGCATAG
AA sequence Show only first row Show all	>Lus10014748 pacid=23165582 polypeptide=Lus10014748 locus=Lus10014748.g ID=Lus10014748.BGIv1.0 annot-version=v1.0 MGELDLRMCLPSYGDRVPASSTRAHHSSVQWHRLDWVMMQIGMAEPIPQWETGESEAIGLLEIIQRNDRRAVTRLSHYRWLWKMRLEHVA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014748 [exp]	0	1
					Lus10000351 [exp]	1.7	1.0000
					Lus10002886 [exp]	2.4	1.0000
AT5G55050			GDSL-like Lipase/Acylhydrolase...		Lus10021543 [exp]	3.0	1.0000
AT3G26880			Plant self-incompatibility pro...		Lus10022631 [exp]	4.0	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10022782 [exp]	4.5	1.0000
					Lus10036778 [exp]	4.6	0.8695
					Lus10023108 [exp]	4.9	1.0000
AT5G50790		SWEET10, AtSWEE...	Nodulin MtN3 family protein (....		Lus10023249 [exp]	5.3	1.0000
					Lus10024321 [exp]	5.7	1.0000
AT2G02850		ARPN	plantacyanin (.1)		Lus10028396 [exp]	6.0	1.0000

Compare expression of checked genes

Lus10014748 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.