Lus10014751 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G30570 124 / 2e-37 PSBW photosystem II reaction center W (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033862 211 / 1e-71 AT2G30570 137 / 2e-42 photosystem II reaction center W (.1)
Lus10024858 120 / 6e-36 AT2G30570 132 / 1e-40 photosystem II reaction center W (.1)
Lus10018771 104 / 2e-30 AT2G30570 100 / 2e-29 photosystem II reaction center W (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G218800 139 / 2e-43 AT2G30570 113 / 3e-33 photosystem II reaction center W (.1)
Potri.002G044300 138 / 8e-43 AT2G30570 120 / 8e-36 photosystem II reaction center W (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07123 PsbW Photosystem II reaction centre W protein (PsbW)
Representative CDS sequence
>Lus10014751 pacid=23165592 polypeptide=Lus10014751 locus=Lus10014751.g ID=Lus10014751.BGIv1.0 annot-version=v1.0
ATGGCATCCATCTCCGCCGCCGCATCCTCCTTCGTCGTACAACCACCTCTCCTTCACACTCCCTCCCTGCGCGTCTCATCCGTACCAGTTCTAGGGCTGC
CGGCTATGTCTAGGAATAAGGGTAGAGTGGTGAAGTGTTGCGCGAGAAGCAACGGATCAGTGGAAGAGAATATTGAGGAGAAGGGGATGGGAGGTTCATT
GATGGCGGCTGCGGCAGTGTGCGCGACGGCCGCGGTGTCGAGCCCGGTGATGGCGCTGGTGGACGACAGGATGAGCACGGAAGGAACCGGGTTGCCGTTC
GGGTTGAGCAACAACCTACTCGGGTGGATATTGTTGGGAGTGTTCGGACTCATCTGGTCTCTCTACACCGTCTACACCTCTGGTCTCGACGAGGACGAAG
AATCCGGATTGTCCCTCTAA
AA sequence
>Lus10014751 pacid=23165592 polypeptide=Lus10014751 locus=Lus10014751.g ID=Lus10014751.BGIv1.0 annot-version=v1.0
MASISAAASSFVVQPPLLHTPSLRVSSVPVLGLPAMSRNKGRVVKCCARSNGSVEENIEEKGMGGSLMAAAAVCATAAVSSPVMALVDDRMSTEGTGLPF
GLSNNLLGWILLGVFGLIWSLYTVYTSGLDEDEESGLSL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G30570 PSBW photosystem II reaction center... Lus10014751 0 1
AT3G12780 PGK1 phosphoglycerate kinase 1 (.1) Lus10031744 1.4 0.9626
AT3G12780 PGK1 phosphoglycerate kinase 1 (.1) Lus10031168 2.0 0.9609
AT3G61220 SDR1 short-chain dehydrogenase/redu... Lus10014694 3.2 0.9380
AT4G37200 HCF164 HIGH CHLOROPHYLL FLUORESCENCE ... Lus10022477 3.3 0.9377
AT4G25910 ATCNFU3, NFU3 NFU domain protein 3 (.1) Lus10001634 3.5 0.9468
AT1G74470 Pyridine nucleotide-disulphide... Lus10001642 3.9 0.9439
AT1G74470 Pyridine nucleotide-disulphide... Lus10021665 4.9 0.9359
AT2G18940 Tetratricopeptide repeat (TPR)... Lus10000035 5.1 0.9355
AT1G19740 ATP-dependent protease La (LON... Lus10006131 5.2 0.9388
AT4G34190 SEP1 stress enhanced protein 1 (.1) Lus10002821 5.7 0.9410

Lus10014751 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.