Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G33100 105 / 3e-31 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033863 [exp] 179 / 1e-60 AT4G33100 106 / 1e-31 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G224400 [exp] 117 / 4e-36 AT4G33100 108 / 1e-32 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05254 [flax] [poplar] UPF0203 Uncharacterised protein family (UPF0203)
Representative CDS sequence Show only first row Show all	>Lus10014752 pacid=23165613 polypeptide=Lus10014752 locus=Lus10014752.g ID=Lus10014752.BGIv1.0 annot-version=v1.0 ATGGGGATTATGAGAAAAGAGAAGCAACTTCCAACTCTCTCTTCAACTTCGCCTTGTGCTTCTCTCAGATCAGCTTATCACATTTGCTTCAACAGGTGGT ACTCGGAGAAGTTTGCAAAGGGTCAGTGGGACAGAATGGAATGCGTTTCTGAGTGGGAAAACTACAAGGATTGCCTCTCTAAGCATTTGGAGGATAAGCA GCTGCGTCGTTTCTTGGAGGCTGAACTTGTTCCCGGCGACTTGGTGGGTTCCGCCACATCTGCAACAAATTGA
AA sequence Show only first row Show all	>Lus10014752 pacid=23165613 polypeptide=Lus10014752 locus=Lus10014752.g ID=Lus10014752.BGIv1.0 annot-version=v1.0 MGIMRKEKQLPTLSSTSPCASLRSAYHICFNRWYSEKFAKGQWDRMECVSEWENYKDCLSKHLEDKQLRRFLEAELVPGDLVGSATSATN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G33100			unknown protein		Lus10014752 [exp]	0	1
AT1G56140			Leucine-rich repeat transmembr...		Lus10020688 [exp]	3.5	0.8509
AT2G34160			Alba DNA/RNA-binding protein (...		Lus10043279 [exp]	3.7	0.8660
AT5G38720			unknown protein		Lus10008877 [exp]	4.5	0.8612
AT5G01630		BRCA2(V), ATBRC...	BRCA2-like B (.1)		Lus10000316 [exp]	8.1	0.8229
AT3G52040			unknown protein		Lus10039586 [exp]	8.5	0.8481
AT5G26800			unknown protein		Lus10031426 [exp]	9.7	0.8428
AT4G16510			YbaK/aminoacyl-tRNA synthetase...		Lus10000734 [exp]	10.6	0.7906
AT5G44280		ATRING1A	ARABIDOPSIS THALIANA RING 1A, ...		Lus10018609 [exp]	11.4	0.8256
AT1G23220			Dynein light chain type 1 fami...		Lus10031734 [exp]	12.4	0.8105
AT3G51060		SRS1, STY1	STYLISH 1, SHI RELATED SEQUENC...		Lus10041803 [exp]	19.6	0.8014

Compare expression of checked genes

Lus10014752 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.