Lus10014755 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G43540 62 / 1e-12 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT3G09290 61 / 7e-12 C2H2ZnF TAC1 telomerase activator1 (.1)
AT2G37740 58 / 2e-10 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1)
AT3G53820 56 / 2e-10 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
AT3G23130 56 / 8e-10 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1)
AT4G17810 56 / 9e-10 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1)
AT5G06070 53 / 6e-09 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1)
AT3G23140 52 / 1e-08 C2H2ZnF URO UPRIGHT ROSETTE, C2H2 and C2HC zinc fingers superfamily protein (.1)
AT2G42410 52 / 2e-08 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1)
AT5G27880 47 / 1e-06 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033867 257 / 3e-89 AT5G43540 65 / 1e-13 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10021213 65 / 2e-13 AT3G09290 73 / 2e-16 telomerase activator1 (.1)
Lus10022204 63 / 2e-13 AT3G09290 67 / 2e-15 telomerase activator1 (.1)
Lus10040767 64 / 1e-12 AT3G09290 71 / 5e-15 telomerase activator1 (.1)
Lus10021881 63 / 2e-12 AT5G43540 67 / 3e-14 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10041160 62 / 4e-12 AT5G43540 69 / 8e-15 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10024363 58 / 1e-10 AT3G53820 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1)
Lus10021490 57 / 7e-10 AT2G37740 103 / 1e-25 zinc-finger protein 10 (.1)
Lus10004705 56 / 7e-10 AT2G37740 100 / 1e-25 zinc-finger protein 10 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G041600 90 / 5e-23 AT4G17810 65 / 6e-13 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.005G221500 83 / 2e-20 AT5G43540 61 / 6e-12 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.010G074400 67 / 6e-14 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.008G164100 66 / 1e-13 AT5G43540 69 / 3e-15 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.016G101300 65 / 1e-13 AT3G53820 92 / 2e-24 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.009G037100 65 / 2e-13 AT3G53820 74 / 5e-17 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.006G089301 61 / 3e-12 AT3G53820 96 / 1e-25 C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.016G101400 62 / 1e-11 AT2G37740 108 / 3e-27 zinc-finger protein 10 (.1)
Potri.010G199800 59 / 1e-10 AT5G06070 100 / 4e-25 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1)
Potri.006G089600 58 / 2e-10 AT2G37740 102 / 2e-25 zinc-finger protein 10 (.1)
PFAM info
Representative CDS sequence
>Lus10014755 pacid=23165656 polypeptide=Lus10014755 locus=Lus10014755.g ID=Lus10014755.BGIv1.0 annot-version=v1.0
ATGAGTTCCAGCGACGAAACAGAGGCTTCGTCGGAGTTGGGAATGGGAAGATCATACGAGTGTGTGTTCTGCAAGAGAGGATTCACCACCGCACAGGCCT
TAGGTGGCCACATGAACATCCACCGCAAAGACCGCCCCTCCGCGGCCACCAAACCCAGACCTAATCCCACTACTAATCACAATTACAGACTTAATCACGA
TTATGGTTTCAATCAGATGAGTTTCCCTCTTCACCACTACCCTTCCCGCCCAGCCGCTCACGCATTTTTCCCATCGCCGGTTATATCAGCCGGCGGTGGC
GGTGGGGAGGGTCATCATCACTTGTACGTGCAGGCTGCGCCGGCTTACTTGGATTTATTCGGGGAGGACAGCTGGCGGAGCGGAGATCAGACAAAAGAGA
AGGAGTATGAGTTTGCAGGCGGCGGTGAAGGAGACGGCTTAGACTTGGAGCTACGACTTGGTCATCACCACGGCGGCGGTCGGCAGTATTAA
AA sequence
>Lus10014755 pacid=23165656 polypeptide=Lus10014755 locus=Lus10014755.g ID=Lus10014755.BGIv1.0 annot-version=v1.0
MSSSDETEASSELGMGRSYECVFCKRGFTTAQALGGHMNIHRKDRPSAATKPRPNPTTNHNYRLNHDYGFNQMSFPLHHYPSRPAAHAFFPSPVISAGGG
GGEGHHHLYVQAAPAYLDLFGEDSWRSGDQTKEKEYEFAGGGEGDGLDLELRLGHHHGGGRQY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G43540 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10014755 0 1
AT5G43540 C2H2ZnF C2H2 and C2HC zinc fingers sup... Lus10033867 1.4 0.9717
AT4G37320 CYP81D5 "cytochrome P450, family 81, s... Lus10000038 3.5 0.9705
AT2G37050 Leucine-rich repeat protein ki... Lus10004275 5.5 0.9683
AT4G37320 CYP81D5 "cytochrome P450, family 81, s... Lus10024078 6.3 0.9661
AT5G23810 AAP7 amino acid permease 7 (.1.2) Lus10010580 8.4 0.9619
AT5G13750 ZIFL1 zinc induced facilitator-like ... Lus10034847 8.8 0.9604
AT1G62422 unknown protein Lus10031521 10.5 0.9385
AT5G65030 unknown protein Lus10014339 12.3 0.9385
AT1G44170 ALDH4, ALDH3H1 aldehyde dehydrogenase 4, alde... Lus10029684 13.0 0.9498
AT3G46540 ENTH/VHS family protein (.1) Lus10040297 13.9 0.9576

Lus10014755 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.