Lus10014758 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G61460 71 / 5e-17 BRH1 brassinosteroid-responsive RING-H2 (.1)
AT1G63840 58 / 5e-12 RING/U-box superfamily protein (.1)
AT5G41400 48 / 2e-08 RING/U-box superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036378 111 / 2e-32 AT3G61460 210 / 5e-70 brassinosteroid-responsive RING-H2 (.1)
Lus10032290 59 / 2e-12 AT3G61460 200 / 2e-66 brassinosteroid-responsive RING-H2 (.1)
Lus10024657 59 / 2e-12 AT3G61460 200 / 4e-66 brassinosteroid-responsive RING-H2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G161900 75 / 9e-19 AT3G61460 234 / 7e-80 brassinosteroid-responsive RING-H2 (.1)
Potri.014G087700 73 / 5e-18 AT3G61460 220 / 2e-74 brassinosteroid-responsive RING-H2 (.1)
Potri.003G130900 61 / 4e-13 AT1G63840 197 / 4e-65 RING/U-box superfamily protein (.1)
Potri.001G101000 41 / 1e-05 AT3G61460 171 / 9e-55 brassinosteroid-responsive RING-H2 (.1)
PFAM info
Representative CDS sequence
>Lus10014758 pacid=23150232 polypeptide=Lus10014758 locus=Lus10014758.g ID=Lus10014758.BGIv1.0 annot-version=v1.0
ATGGGGTTTCCGATCGCATACACCGAGGTTTTCATGCCGAAGATCTTCGTCCATGCGCTTTCCTTCCTCGGATTCCTCCGTACCGCAATCATTTCTCTCT
TCACCGTCCTCGGCCTCTCCGACTTCATCGAAGCTGCCGCCGACAACATCTGGCAGCAGGACTACTACTCGCAGCCGCCGTCCACGGCGGCCTGTGAGGA
GCGGACGAGATCAGGTGGCTGA
AA sequence
>Lus10014758 pacid=23150232 polypeptide=Lus10014758 locus=Lus10014758.g ID=Lus10014758.BGIv1.0 annot-version=v1.0
MGFPIAYTEVFMPKIFVHALSFLGFLRTAIISLFTVLGLSDFIEAAADNIWQQDYYSQPPSTAACEERTRSGG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G61460 BRH1 brassinosteroid-responsive RIN... Lus10014758 0 1
AT3G61460 BRH1 brassinosteroid-responsive RIN... Lus10036378 1.0 0.9623
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10015496 3.2 0.9078
AT3G07790 DGCR14-related (.1) Lus10006367 4.5 0.8958
AT3G25780 AOC3, AOC2 allene oxide cyclase 3 (.1) Lus10017571 4.6 0.9061
AT1G04000 unknown protein Lus10008237 6.3 0.8689
AT1G02816 Protein of unknown function, D... Lus10009854 6.7 0.8942
AT1G07710 Ankyrin repeat family protein ... Lus10024440 6.7 0.8826
AT3G07360 ATPUB9 ARABIDOPSIS THALIANA PLANT U-B... Lus10025885 8.4 0.8738
AT2G17840 ERD7 EARLY-RESPONSIVE TO DEHYDRATIO... Lus10034499 8.8 0.8740
AT5G13860 ELC-LIKE, ATELC... ELCH-like (.1) Lus10041612 9.9 0.8806

Lus10014758 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.