Lus10014763 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63800 282 / 3e-98 UBC5 ubiquitin-conjugating enzyme 5 (.1)
AT5G41340 282 / 3e-98 ATUBC4, UBC4 ubiquitin conjugating enzyme 4 (.1)
AT2G46030 265 / 9e-92 UBC6 ubiquitin-conjugating enzyme 6 (.1)
AT1G64230 100 / 4e-27 UBC28 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
AT3G08690 99 / 9e-27 ATUBC11, UBC11 ubiquitin-conjugating enzyme 11 (.1.2)
AT5G56150 99 / 2e-26 UBC30 ubiquitin-conjugating enzyme 30 (.1.2)
AT2G02760 98 / 3e-26 ATUBC2 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
AT4G27960 97 / 5e-26 UBC9 ubiquitin conjugating enzyme 9 (.1.2)
AT5G41700 97 / 5e-26 ATUBC8, UBC8 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
AT5G53300 96 / 2e-25 UBC10 ubiquitin-conjugating enzyme 10 (.1.2.3.4)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10036372 312 / 6e-110 AT1G63800 286 / 9e-100 ubiquitin-conjugating enzyme 5 (.1)
Lus10002359 268 / 3e-92 AT1G63800 275 / 5e-95 ubiquitin-conjugating enzyme 5 (.1)
Lus10032274 260 / 6e-90 AT1G63800 278 / 5e-97 ubiquitin-conjugating enzyme 5 (.1)
Lus10042136 246 / 3e-84 AT1G63800 267 / 2e-92 ubiquitin-conjugating enzyme 5 (.1)
Lus10024638 219 / 4e-73 AT1G63800 229 / 2e-77 ubiquitin-conjugating enzyme 5 (.1)
Lus10014187 100 / 6e-27 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10022726 100 / 6e-27 AT1G64230 303 / 7e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10021385 99 / 1e-26 AT1G64230 302 / 1e-107 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Lus10036727 99 / 1e-26 AT2G02760 310 / 1e-110 ubiquitin-conjugating enzyme 2, ubiquiting-conjugating enzyme 2 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G161000 305 / 2e-107 AT1G63800 288 / 1e-100 ubiquitin-conjugating enzyme 5 (.1)
Potri.014G086600 304 / 4e-107 AT1G63800 283 / 8e-99 ubiquitin-conjugating enzyme 5 (.1)
Potri.001G101900 292 / 2e-102 AT5G41340 292 / 3e-102 ubiquitin conjugating enzyme 4 (.1)
Potri.003G129700 283 / 6e-99 AT5G41340 284 / 5e-99 ubiquitin conjugating enzyme 4 (.1)
Potri.015G073400 255 / 1e-87 AT5G41340 268 / 1e-92 ubiquitin conjugating enzyme 4 (.1)
Potri.019G083800 101 / 2e-27 AT5G56150 280 / 1e-98 ubiquitin-conjugating enzyme 30 (.1.2)
Potri.011G168200 100 / 7e-27 AT1G64230 295 / 1e-104 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
Potri.006G110200 99 / 1e-26 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.019G131400 99 / 1e-26 AT5G41700 304 / 4e-108 ARABIDOPSIS THALIANA UBIQUITIN CONJUGATING ENZYME 8, ubiquitin conjugating enzyme 8 (.1.2.3.4.5)
Potri.003G136200 99 / 1e-26 AT1G64230 304 / 4e-108 ubiquitin-conjugating enzyme 28 (.1.2.3.4.5)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0208 UBC PF00179 UQ_con Ubiquitin-conjugating enzyme
Representative CDS sequence
>Lus10014763 pacid=23150223 polypeptide=Lus10014763 locus=Lus10014763.g ID=Lus10014763.BGIv1.0 annot-version=v1.0
ATGTCGTCTCCAAGCAAACGCAGAGAGATGGACTTGATGAAACTGATGATGAGTGATTATAAGGTGGAGCTGATCAATGATGGGATGCAAGAGTTCTATG
TTTATTTCAATGGACCCGACGACAGTCCATACCATGGAGGAGTATGGAGAATTAGAGTTGAGCTGCCAGAGGGTTATCCCTACAAATCCCCATCAATAGG
GTTTATCAATAAGATCTACCACCCAAATGTTGATGAAATGTCCGGCTCGGTTTGTTTGGATGTCATCAATCAAACTTGGAGCCCGATGTTTGATTTGGTG
AATGTGTTTGAAGTGTTCCTTCCGCAGCTTCTCTTGTATCCTAACCCGTCAGATCCATTGAACGGTGAGGCTGCAGCTCTGATGATGCGTGACCGCCCGG
CTTATGATTTTAGAGTTAAAGAATACTGTCAGAAGTATGCAAAGCCTGAAGATGCTGGAGCCACTGCAGAAGAAAAGGAGAGCGACGACGACGAAATGAG
TGAATATGAGTACGAATCCGAGGACGAGATGGCTGGACCAGCTGATCCTTAA
AA sequence
>Lus10014763 pacid=23150223 polypeptide=Lus10014763 locus=Lus10014763.g ID=Lus10014763.BGIv1.0 annot-version=v1.0
MSSPSKRREMDLMKLMMSDYKVELINDGMQEFYVYFNGPDDSPYHGGVWRIRVELPEGYPYKSPSIGFINKIYHPNVDEMSGSVCLDVINQTWSPMFDLV
NVFEVFLPQLLLYPNPSDPLNGEAAALMMRDRPAYDFRVKEYCQKYAKPEDAGATAEEKESDDDEMSEYEYESEDEMAGPADP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G63800 UBC5 ubiquitin-conjugating enzyme 5... Lus10014763 0 1
AT5G55860 Plant protein of unknown funct... Lus10022531 2.0 0.9557
AT5G11680 unknown protein Lus10020200 2.4 0.9496
AT5G08560 transducin family protein / WD... Lus10001046 5.7 0.9457
AT3G26935 DHHC-type zinc finger family p... Lus10016754 6.9 0.9442
AT1G15860 Domain of unknown function (DU... Lus10039198 7.5 0.9319
AT4G29890 choline monooxygenase, putativ... Lus10032689 8.4 0.9420
AT1G30500 CCAAT NF-YA7 "nuclear factor Y, subunit A7"... Lus10023358 11.0 0.9265
AT2G36020 HVA22J HVA22-like protein J (.1) Lus10021299 13.2 0.9444
AT5G61500 ATATG3 autophagy 3 (APG3) (.1) Lus10009664 15.5 0.9335
AT3G26935 DHHC-type zinc finger family p... Lus10022451 16.4 0.9319

Lus10014763 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.