Lus10014788 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G091100 42 / 4e-05 AT3G48490 48 / 2e-07 unknown protein
PFAM info
Representative CDS sequence
>Lus10014788 pacid=23150204 polypeptide=Lus10014788 locus=Lus10014788.g ID=Lus10014788.BGIv1.0 annot-version=v1.0
ATGTTCGGAAGGTTGAGACCGCCTTCGTCTTCCCTGGACAGTTTAGAACTGGAGAGGTCACATTCCAAGTTCTTCAAAGACGATTCTCTCTCCATCTACG
AGGCTACGTTGATGAAGCTGAAGCGAGGTTCTCAACTTGCTACTACCTACAATCTTCATCCTCCCATCGACGATCTAGTGGATGCTGAACAAATTGATTG
CATTTCTTCCATTTCTTCAACGACTACTTGTGAGGGCCAGTCTGCCCAACCTCTGGCTGCTGCAAATTGTTCTTCTTCCCCAATTTCTTCAACTTCAACT
GTTGACTTGAAACGCCAGCCGTCAGTTGTCGACCTGTTCTCTAAGTACAAACGGTCGCATCAACAATCTCAAACAGATATTACGATGGCAGCCTCTGATG
ATGTCGACTTGGGGACCAGTTCATAG
AA sequence
>Lus10014788 pacid=23150204 polypeptide=Lus10014788 locus=Lus10014788.g ID=Lus10014788.BGIv1.0 annot-version=v1.0
MFGRLRPPSSSLDSLELERSHSKFFKDDSLSIYEATLMKLKRGSQLATTYNLHPPIDDLVDAEQIDCISSISSTTTCEGQSAQPLAAANCSSSPISSTST
VDLKRQPSVVDLFSKYKRSHQQSQTDITMAASDDVDLGTSS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48490 unknown protein Lus10014788 0 1
AT4G08520 SNARE-like superfamily protein... Lus10037624 5.4 0.7205
AT3G10330 Cyclin-like family protein (.1... Lus10031056 9.9 0.6628
AT2G05840 PAA2 20S proteasome subunit PAA2 (.... Lus10027669 11.3 0.6960
AT4G17420 Tryptophan RNA-binding attenua... Lus10007800 11.7 0.6822
AT3G66654 Cyclophilin-like peptidyl-prol... Lus10016265 15.1 0.6988
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10023053 17.0 0.6591
AT3G59920 ATGDI2 RAB GDP dissociation inhibitor... Lus10027094 32.6 0.6854
AT5G65770 CRWN4, LINC4 CROWDED NUCLEI 4, little nucle... Lus10019257 40.1 0.5498
AT4G08520 SNARE-like superfamily protein... Lus10006883 41.5 0.6802
AT3G25220 FKBP15-1 FK506-binding protein 15 kD-1 ... Lus10002339 41.9 0.6685

Lus10014788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.