Lus10014790 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22240 363 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT4G04020 353 / 3e-122 FIB fibrillin (.1)
AT2G35490 220 / 4e-69 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT2G42130 57 / 1e-09 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
AT3G58010 54 / 3e-08 PGL34 plastoglobulin 34kD (.1)
AT5G09820 53 / 7e-08 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
AT2G46910 49 / 1e-06 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26080 44 / 4e-05 plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G26070 43 / 0.0002 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
AT3G23400 42 / 0.0003 FIB4 fibrillin 4, Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001099 576 / 0 AT4G22240 362 / 5e-126 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10030987 218 / 2e-68 AT2G35490 354 / 5e-121 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10035384 218 / 3e-68 AT2G35490 357 / 5e-122 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10033514 67 / 2e-12 AT5G09820 270 / 3e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10020860 67 / 2e-12 AT5G09820 269 / 5e-91 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Lus10012003 61 / 4e-10 AT2G42130 383 / 3e-134 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Lus10020982 56 / 9e-09 AT3G26070 265 / 1e-89 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Lus10016263 55 / 2e-08 AT2G42130 346 / 1e-120 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Lus10004171 53 / 6e-08 AT2G42130 378 / 3e-133 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G003200 368 / 7e-128 AT4G22240 380 / 1e-132 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G137900 246 / 2e-79 AT2G35490 301 / 3e-100 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.003G095900 237 / 7e-76 AT2G35490 334 / 5e-113 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.001G309300 62 / 7e-11 AT5G09820 268 / 7e-90 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2)
Potri.006G192200 61 / 1e-10 AT2G42130 361 / 1e-125 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Potri.001G209600 56 / 5e-09 AT3G26070 253 / 7e-85 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.016G045900 55 / 2e-08 AT2G42130 366 / 1e-127 Plastid-lipid associated protein PAP / fibrillin family protein (.1.2.3.4.5)
Potri.003G020700 51 / 3e-07 AT3G26070 244 / 6e-81 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
Potri.002G183700 45 / 2e-05 AT2G46910 366 / 2e-128 Plastid-lipid associated protein PAP / fibrillin family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04755 PAP_fibrillin PAP_fibrillin
Representative CDS sequence
>Lus10014790 pacid=23150174 polypeptide=Lus10014790 locus=Lus10014790.g ID=Lus10014790.BGIv1.0 annot-version=v1.0
ATGGCATCCACCACCTCTCGATTGATTCTTCCATGCCATACTCTCTCCACCACTCCTCAAAACACCTTCTTCGCTACCTATGCTCGTCGTCCGGCCATCC
ATTTCCCCGCTGCGGCCTTAACTCTGCAGCAGCTCTCATCCAAACAGTTATTCCGCAACTCACGCCCTCATGTCTTGGTTCGTGCAGCCGGAGAAGGGGT
GTCCTCCTCGTCGTCCTCCTCCTCCTCGTCGACCCCAGGTCAGGCATCAACGGTCACCGTTCAATCGGAGTCAGAGACAGGAAAGTTGAAGAAACAGTTG
GTGGATTGCTTTTACGGTACGGACCGTGGGTTGAGAGCAAGCAGCGAAACCAGAGCTGAGATTGGGGAGCTCATCACCCAGCTGGAATCAAAGAACCCTA
CCCCTTCACCTACCGACGCTTTACCTCTTCTCAAGGGCAAGTGGATTCTCTCGTACACGTCTTTCCCGGGGCTGTTCCCTTTGCTGGCGAGGGGGGCTCC
TTCTCTGTTGATGGTGGATGAAATATCTCAAACCATAGATTCCGAGAATTTCACCGTCCAGAACTCTGTTCGATTTGCTAGCCCTTATGCTACCACTTCC
ATCACCACCAATGCCAAATTCGAAGTTAGAAGCCCTAAGCGTGTCCAGATAAAGTTTGAAGAAGGGGTGATTGGGACTCCTCAGCTGACTGATTCCATAG
TATTACCAGAGAGCGTGGAATTTCTGGGACAGAAGATAGACCTTACCCCTTTCAAAGGGTTGATCACCTCTGTTCAGGACACTGCTTCCACCGTTGCCAA
GACCATATCCAGCCAGCCACCCTTCAAGTTTTCCATCCCAAACACTAGCACTGCAGATTCTTGGTTACTCACCACCTACCTCGACCAAGACCTTCGCATT
TCGAGAGGGGATGCTGGCAGCGTCTTCGTGCTTCTTAAAGAAGGAAGCCCTCTCCTTGCTTCCCTTTGA
AA sequence
>Lus10014790 pacid=23150174 polypeptide=Lus10014790 locus=Lus10014790.g ID=Lus10014790.BGIv1.0 annot-version=v1.0
MASTTSRLILPCHTLSTTPQNTFFATYARRPAIHFPAAALTLQQLSSKQLFRNSRPHVLVRAAGEGVSSSSSSSSSSTPGQASTVTVQSESETGKLKKQL
VDCFYGTDRGLRASSETRAEIGELITQLESKNPTPSPTDALPLLKGKWILSYTSFPGLFPLLARGAPSLLMVDEISQTIDSENFTVQNSVRFASPYATTS
ITTNAKFEVRSPKRVQIKFEEGVIGTPQLTDSIVLPESVEFLGQKIDLTPFKGLITSVQDTASTVAKTISSQPPFKFSIPNTSTADSWLLTTYLDQDLRI
SRGDAGSVFVLLKEGSPLLASL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G22240 Plastid-lipid associated prote... Lus10014790 0 1
AT4G03510 ATRMA1, RMA1 RING membrane-anchor 1 (.1.2) Lus10033697 1.0 0.9151
AT3G01400 ARM repeat superfamily protein... Lus10018685 2.2 0.8804
AT4G30440 GAE1 UDP-D-glucuronate 4-epimerase ... Lus10023213 3.7 0.8974
AT3G09032 unknown protein Lus10027777 6.3 0.8636
AT3G06483 ATPDHK, PDK pyruvate dehydrogenase kinase ... Lus10017117 7.7 0.8830
AT1G78600 CO BBX22, DBB3, ST... SALT TOLERANCE HOMOLOG 3, DOUB... Lus10042498 7.9 0.8178
AT1G08250 AtADT6, ADT6 Arabidopsis thaliana arogenate... Lus10019526 7.9 0.8830
AT3G60520 unknown protein Lus10028179 8.4 0.8630
AT4G17440 Protein of unknown function (D... Lus10004378 8.4 0.8530
AT3G61200 Thioesterase superfamily prote... Lus10000809 8.8 0.8771

Lus10014790 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.