Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G15360 175 / 3e-56 ATHM4, ATM4, TRX-M4 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) AT1G03680 169 / 7e-54 ATHM1, ATM1, TRX-M1 ARABIDOPSIS THIOREDOXIN M-TYPE 1, thioredoxin M-type 1 (.1) AT4G03520 166 / 8e-53 ATHM2 Thioredoxin superfamily protein (.1.2) AT2G15570 133 / 4e-40 TRX-M3, GAT1, ATHM3, ATM3 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) AT1G76760 91 / 3e-23 ATY1, TRX-Y1 thioredoxin Y1 (.1) AT1G43560 87 / 6e-22 ATY2 thioredoxin Y2 (.1) AT1G50320 79 / 1e-18 ATHX, ATX thioredoxin X (.1) AT3G51030 74 / 3e-17 ATTRX1, ATTRXH1 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1) AT1G19730 72 / 8e-17 ATTRX4, ATH4 thioredoxin H-type 4, Thioredoxin superfamily protein (.1) AT5G42980 67 / 8e-15 ATTRXH3, ATTRX3, ATH3 THIOREDOXIN H3, thioredoxin H-type 3, thioredoxin 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040887 [exp] 249 / 9e-86 AT3G15360 182 / 4e-59 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029752 [exp] 172 / 3e-55 AT3G15360 165 / 3e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10029755 [exp] 172 / 3e-55 AT3G15360 162 / 3e-51 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10042784 [exp] 171 / 6e-55 AT3G15360 165 / 4e-52 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Lus10014069 [exp] 121 / 5e-35 AT2G15570 182 / 3e-59 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10019847 [exp] 121 / 5e-35 AT2G15570 184 / 8e-60 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Lus10018875 [exp] 86 / 2e-21 AT1G76760 176 / 6e-57 thioredoxin Y1 (.1) Lus10028569 [exp] 86 / 2e-21 AT1G76760 174 / 3e-56 thioredoxin Y1 (.1) Lus10000802 [exp] 71 / 4e-16 AT3G51030 165 / 5e-54 ARABIDOPSIS THALIANA THIOREDOXIN H-TYPE 1, thioredoxin H-type 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G401500 [exp] 208 / 2e-69 AT3G15360 171 / 2e-54 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.011G120700 [exp] 206 / 3e-68 AT3G15360 190 / 1e-61 ARABIDOPSIS THIOREDOXIN M-TYPE 4, thioredoxin M-type 4 (.1) Potri.013G132200 [exp] 180 / 3e-58 AT4G03520 173 / 4e-55 Thioredoxin superfamily protein (.1.2) Potri.019G111200 [exp] 175 / 3e-56 AT4G03520 172 / 9e-55 Thioredoxin superfamily protein (.1.2) Potri.005G058400 [exp] 172 / 5e-55 AT4G03520 157 / 6e-49 Thioredoxin superfamily protein (.1.2) Potri.002G073000 [exp] 166 / 2e-52 AT4G03520 152 / 6e-47 Thioredoxin superfamily protein (.1.2) Potri.005G186800 [exp] 164 / 6e-52 AT4G03520 152 / 3e-47 Thioredoxin superfamily protein (.1.2) Potri.009G100700 [exp] 130 / 1e-38 AT2G15570 193 / 2e-63 THIOREDOXIN-M3, GFP ARRESTED TRAFFICKING 1, Arabidopsis thioredoxin M-type 3, Thioredoxin superfamily protein (.1.2) Potri.005G193400 [exp] 89 / 1e-22 AT1G76760 198 / 2e-65 thioredoxin Y1 (.1) Potri.002G066800 [exp] 87 / 5e-22 AT1G76760 192 / 2e-63 thioredoxin Y1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [flax] [poplar] Thioredoxin PF00085 [flax] [poplar] Thioredoxin Thioredoxin
Representative CDS sequence Show only first row Show all	>Lus10014798 pacid=23150203 polypeptide=Lus10014798 locus=Lus10014798.g ID=Lus10014798.BGIv1.0 annot-version=v1.0 ATGGCCACCATCGCTGTTCTTGGATCCCTTCACCTCCCTCGCTCCTCGCCCTCCTCTTTCTCTCCTTCTTCCCTTCTCTCCCCAAATCACAGATCCCTCC CTCTTCCTCTCAACCTCCGCTTTTCCCGATCCTCCCTCGCTCTCCATTCTTCCCGTCGCCGATCCTCCTCCATCGTTTGTGAGGCCCAGAACACTGCTAC TCAAGTTGCAGATGTGACTGATAAAACATGGGAGTCCCTGGTTGTTGAATCGGAAACCCCTGTTCTGGTGGAATTTTGGGCTCCATGGTGCGGCCCCTGC AGAATGATTCACCCCATCATCGACGAAGTGGCGAAGCAGTACGCAGGGAAGCTCAAATGTTACAAGCTCAACACAGATGACAGTCCATCGGTTGCAACCC AGTACGGAATCCGCAGCATCCCAACGGTAATCATCTTCAAGGAAGGGGAGAAGAAAGATGCTGTTATTGGTGCTGTTCCCAAATCCACCTTAACCACCTC CATCGAGAAGTTCTTGTAG
AA sequence Show only first row Show all	>Lus10014798 pacid=23150203 polypeptide=Lus10014798 locus=Lus10014798.g ID=Lus10014798.BGIv1.0 annot-version=v1.0 MATIAVLGSLHLPRSSPSSFSPSSLLSPNHRSLPLPLNLRFSRSSLALHSSRRRSSSIVCEAQNTATQVADVTDKTWESLVVESETPVLVEFWAPWCGPC RMIHPIIDEVAKQYAGKLKCYKLNTDDSPSVATQYGIRSIPTVIIFKEGEKKDAVIGAVPKSTLTTSIEKFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Lus10014798 [exp]	0	1
AT3G15360		ATHM4, ATM4, TR...	ARABIDOPSIS THIOREDOXIN M-TYPE...		Lus10040887 [exp]	1.0	0.9018
AT3G24050	GATA	GATA1	GATA transcription factor 1 (....		Lus10023684 [exp]	2.4	0.8059
AT3G48890		MSBP2, ATMP2, A...	MEMBRANE STEROID BINDING PROTE...		Lus10038868 [exp]	8.7	0.7339
AT3G62790			NADH-ubiquinone oxidoreductase...		Lus10035034 [exp]	9.6	0.7920
AT1G11930			Predicted pyridoxal phosphate-...		Lus10015557 [exp]	9.8	0.7361
AT5G13430			Ubiquinol-cytochrome C reducta...		Lus10041513 [exp]	10.4	0.7687
AT3G59280		TXR1	THAXTOMIN A RESISTANT 1, Prote...		Lus10043207 [exp]	11.1	0.7999
AT4G09620			Mitochondrial transcription te...		Lus10009420 [exp]	13.3	0.7669
AT1G29530			unknown protein		Lus10015254 [exp]	14.8	0.7589
AT1G60870		MEE9	maternal effect embryo arrest ...		Lus10022977 [exp]	15.2	0.7370

Compare expression of checked genes

Lus10014798 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.