Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27290 159 / 4e-46 S-locus lectin protein kinase family protein (.1) AT4G21380 138 / 2e-38 ARK3 receptor kinase 3 (.1) AT4G03230 137 / 5e-38 S-locus lectin protein kinase family protein (.1) AT4G27300 135 / 1e-37 S-locus lectin protein kinase family protein (.1) AT1G65800 133 / 8e-37 ARK2 receptor kinase 2 (.1) AT1G65790 131 / 3e-36 ARK1 receptor kinase 1 (.1) AT4G23140 127 / 7e-35 RLK5, CRK6 cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 6 (.2) AT1G11410 127 / 1e-34 S-locus lectin protein kinase family protein (.1) AT4G23160 124 / 2e-33 CRK8 cysteine-rich RLK (RECEPTOR-like protein kinase) 8 (.1) AT4G23290 122 / 3e-33 CRK21 cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.1), cysteine-rich RLK (RECEPTOR-like protein kinase) 21 (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033365 [exp] 178 / 1e-52 AT4G21380 810 / 0.0 receptor kinase 3 (.1) Lus10038555 [exp] 154 / 3e-48 AT4G27300 183 / 4e-54 S-locus lectin protein kinase family protein (.1) Lus10038553 [exp] 164 / 1e-47 AT4G27290 899 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014811 [exp] 164 / 1e-47 AT4G27290 808 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014810 [exp] 160 / 2e-46 AT4G27290 692 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10038552 [exp] 160 / 4e-46 AT4G27290 879 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014813 [exp] 157 / 3e-45 AT4G27290 805 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10014812 [exp] 155 / 2e-44 AT4G27290 749 / 0.0 S-locus lectin protein kinase family protein (.1) Lus10037865 [exp] 150 / 1e-42 AT4G27300 804 / 0.0 S-locus lectin protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G412000 [exp] 179 / 3e-53 AT4G27290 815 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G412377 [exp] 164 / 3e-52 AT1G65790 205 / 4e-62 receptor kinase 1 (.1) Potri.011G125601 [exp] 174 / 2e-51 AT4G27290 914 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G412300 [exp] 174 / 3e-51 AT4G27290 886 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G126151 [exp] 173 / 5e-51 AT4G27290 868 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G129000 [exp] 173 / 6e-51 AT4G27290 818 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.001G412100 [exp] 172 / 1e-50 AT1G11330 600 / 0.0 S-locus lectin protein kinase family protein (.1.2) Potri.011G125050 [exp] 171 / 2e-50 AT4G27290 870 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G128700 [exp] 170 / 8e-50 AT4G27290 840 / 0.0 S-locus lectin protein kinase family protein (.1) Potri.011G128800 [exp] 169 / 2e-49 AT4G27290 856 / 0.0 S-locus lectin protein kinase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0016 [flax] [poplar] PKinase PF07714 [flax] [poplar] PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase CL0016 [flax] [poplar] PF11883 [flax] [poplar] DUF3403 Domain of unknown function (DUF3403)
Representative CDS sequence Show only first row Show all	>Lus10014809 pacid=23150209 polypeptide=Lus10014809 locus=Lus10014809.g ID=Lus10014809.BGIv1.0 annot-version=v1.0 ATGTCACCAGAGTATGTCATGGACGGAATTTATTCGGTTAAGTCAGATGTATTTAGCTTTGGTGTAATGGTGCTGGAGATAGTCAGCGGGGAAAGAAACC GAGGCTTTAACCGCCACGATCATCAACTTAACCTTCTTGGTCATGCGTGGACGTTACAAAAGGAAGATAAAGCTGTGGAATTGATAGACGAAATAATGGA AGAATCTGACGATGAGTGGCATGTATTGCGAGTGATCCATATTGGATTGTTGTGCGTGCAAAAAAACCCAGAAGATCGACCGACCATGTCAACAGTAATG CATATGTTAGATGGAGAAGGGGATCTCTTAGAGCCAAAACAGCCTGGATTCTTTACAGAAAGAGATCTATCAGAAGAAAGTTCTTCTTCTAGTGGTAATA GGGGATCATGTACTAAAGCTACCATGACTGTCACCCAATTACTTGCAAGATGA
AA sequence Show only first row Show all	>Lus10014809 pacid=23150209 polypeptide=Lus10014809 locus=Lus10014809.g ID=Lus10014809.BGIv1.0 annot-version=v1.0 MSPEYVMDGIYSVKSDVFSFGVMVLEIVSGERNRGFNRHDHQLNLLGHAWTLQKEDKAVELIDEIMEESDDEWHVLRVIHIGLLCVQKNPEDRPTMSTVM HMLDGEGDLLEPKQPGFFTERDLSEESSSSSGNRGSCTKATMTVTQLLAR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27290			S-locus lectin protein kinase ...		Lus10014809 [exp]	0	1
AT4G27290			S-locus lectin protein kinase ...		Lus10014808 [exp]	2.8	0.9247
AT2G24240			BTB/POZ domain with WD40/YVTN ...		Lus10036274 [exp]	11.7	0.9319
AT2G23450			Protein kinase superfamily pro...		Lus10011652 [exp]	12.6	0.9374
AT1G10650			SBP (S-ribonuclease binding pr...		Lus10030891 [exp]	13.0	0.9231
AT3G51610		NPU	NO PRIMEXINE AND PLASMA MEMBRA...		Lus10025238 [exp]	20.6	0.8809
AT4G16520		ATG8F	autophagy 8f, Ubiquitin-like s...		Lus10028933 [exp]	24.1	0.9311
AT4G26060			Ribosomal protein L18ae family...		Lus10027625 [exp]	25.8	0.9250
AT2G37710		RLK	receptor lectin kinase (.1)		Lus10033776 [exp]	26.7	0.9049
AT5G41810			unknown protein		Lus10003901 [exp]	30.7	0.9303
AT3G16990			Haem oxygenase-like, multi-hel...		Lus10037751 [exp]	34.4	0.9280

Compare expression of checked genes

Lus10014809 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.