Lus10014816 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G51500 81 / 3e-20 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017918 239 / 1e-82 AT3G51500 91 / 3e-24 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G146400 150 / 2e-47 AT3G51500 56 / 9e-11 unknown protein
PFAM info
Representative CDS sequence
>Lus10014816 pacid=23150150 polypeptide=Lus10014816 locus=Lus10014816.g ID=Lus10014816.BGIv1.0 annot-version=v1.0
ATGCAAGATCCAAGGTTGCCTCTATCTGGTGAGATATCAAACGGTAAACCACGTAAGAAGAAAGGCTCAACTACTAGAGTATCCATGCTTCAGGTGAAAG
GAAACGATGTAAGAGAGATTCAACATGGCCAGCCTCCCTTGTCTGTAAGGAATGCTCAGAAGGTGTCCGGCAAGAACTTGATGAATGAATACGCTCCTAT
GTTTCAGCAGACAGAGAGGTCAAATTCAGATTCCTTGCCTGATTCTTCTGGTTCAGGGAATGATTACAGGGCACTAAGAAGGAAGTATTTGCTGTTGGAG
GAGGAAAGCTTCAGTCTAGGGACGGAGTTGAGAGGTATTGAAGACGAGGTTAATACTCTAGAAGATGAGAAACTTGCGTTGTTAGATCAGCTCATTGTGC
TAGAAGGTCTTGTTGACCCTTCAGAACAAGTCCCTTGA
AA sequence
>Lus10014816 pacid=23150150 polypeptide=Lus10014816 locus=Lus10014816.g ID=Lus10014816.BGIv1.0 annot-version=v1.0
MQDPRLPLSGEISNGKPRKKKGSTTRVSMLQVKGNDVREIQHGQPPLSVRNAQKVSGKNLMNEYAPMFQQTERSNSDSLPDSSGSGNDYRALRRKYLLLE
EESFSLGTELRGIEDEVNTLEDEKLALLDQLIVLEGLVDPSEQVP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G51500 unknown protein Lus10014816 0 1
AT4G33540 metallo-beta-lactamase family ... Lus10027583 2.4 0.8862
AT5G26990 Drought-responsive family prot... Lus10031467 4.1 0.9097
AT2G43210 Ubiquitin-like superfamily pro... Lus10026718 13.5 0.8776
AT2G14850 unknown protein Lus10011422 13.7 0.8655
AT1G47720 OSB1 Organellar Single-stranded, Pr... Lus10021767 13.8 0.8783
AT1G01350 C3HZnF Zinc finger (CCCH-type/C3HC4-t... Lus10009810 15.2 0.8731
AT5G55700 BAM4, BMY6 BETA-AMYLASE 6, beta-amylase 4... Lus10016615 15.5 0.8705
AT3G18620 DHHC-type zinc finger family p... Lus10013426 17.7 0.8877
AT3G50000 ATCKA2, CKA2 "casein kinase II, alpha chain... Lus10011534 19.8 0.8623
AT3G06760 Drought-responsive family prot... Lus10013420 21.6 0.8558

Lus10014816 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.