Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G55490 157 / 2e-50 GINS complex protein (.1) AT1G19080 157 / 2e-50 PSF3, TTN10 TITAN 10, Partner of SLD5 3, GINS complex protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030406 [exp] 207 / 4e-71 AT1G19080 157 / 2e-50 TITAN 10, Partner of SLD5 3, GINS complex protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G189200 [exp] 179 / 3e-59 AT3G55490 271 / 8e-94 GINS complex protein (.1) Potri.008G068100 [exp] 179 / 5e-59 AT3G55490 273 / 1e-94 GINS complex protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05916 [flax] [poplar] Sld5 GINS complex protein
Representative CDS sequence Show only first row Show all	>Lus10014848 pacid=23150149 polypeptide=Lus10014848 locus=Lus10014848.g ID=Lus10014848.BGIv1.0 annot-version=v1.0 ATGGCGGATTACTACGACATTGATGACATTCTTGCTGAAGAAGAGTTTGTACCAGTCATATTTCACAAGGCGGTGAATGGGGTTAAAATCGACGAAAGTT CAGAAAGAGGCTTTGTTGAGAAAGATTCCAAGTCGGAGCTACCATTTTGGCTTGCTCGTGAGTTACACTTGAGACAAGCCGCATCGATCAAAGTTCCTGC CTGTTTCAATAGACAAACGAGGCTAGAAATCGAGGCTGATGCTGGATCTGTTGATTTACGATCCCGCTGTTCATACTTCTATGAATTTGGATGTAAACTC GCACCATAG
AA sequence Show only first row Show all	>Lus10014848 pacid=23150149 polypeptide=Lus10014848 locus=Lus10014848.g ID=Lus10014848.BGIv1.0 annot-version=v1.0 MADYYDIDDILAEEEFVPVIFHKAVNGVKIDESSERGFVEKDSKSELPFWLARELHLRQAASIKVPACFNRQTRLEIEADAGSVDLRSRCSYFYEFGCKL AP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G19080		PSF3, TTN10	TITAN 10, Partner of SLD5 3, G...		Lus10014848 [exp]	0	1
AT3G25980		MAD2	MITOTIC ARREST-DEFICIENT 2, DN...		Lus10006436 [exp]	2.8	0.9087
AT5G35520		MIS12, ATMIS12	MIS12 HOMOLOGUE, ARABIDOPSIS M...		Lus10009016 [exp]	3.9	0.8980
AT5G65120			unknown protein		Lus10016802 [exp]	4.9	0.9050
AT1G61000			unknown protein		Lus10020820 [exp]	6.6	0.9001
AT1G04030			unknown protein		Lus10029611 [exp]	6.9	0.9010
AT4G28950		ATRAC7, ARAC7, ...	Arabidopsis RAC-like 7, RHO-re...		Lus10034932 [exp]	8.1	0.8932
AT1G77580			Plant protein of unknown funct...		Lus10042719 [exp]	12.4	0.8745
AT1G01370		CENH3, HTR12	CENTROMERIC HISTONE H3, Histon...		Lus10008119 [exp]	15.5	0.8768
AT1G77580			Plant protein of unknown funct...		Lus10029679 [exp]	16.0	0.8900
AT3G54560		HTA11	histone H2A 11 (.1)		Lus10024838 [exp]	19.6	0.8831

Compare expression of checked genes

Lus10014848 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.