Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011085 [exp] 74 / 1e-17 AT4G33910 241 / 4e-79 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014856 pacid=23142406 polypeptide=Lus10014856 locus=Lus10014856.g ID=Lus10014856.BGIv1.0 annot-version=v1.0 ATGTTTCTTCCAGGATCTGACTTCTCCAATTGCGTCCCTGTGATAGGAGGATCCTGGTCTAACGTCCAAGCCCCGGAAGCTGCAGTCTTCGTTGCTGGCG ACGAAGAAATTCGAGTACAACTTCATCCCTCCGGGACAGTCTGGGGACGATTCCATCACGCTTATCCCCTTCCAGGCATGTAA
AA sequence Show only first row Show all	>Lus10014856 pacid=23142406 polypeptide=Lus10014856 locus=Lus10014856.g ID=Lus10014856.BGIv1.0 annot-version=v1.0 MFLPGSDFSNCVPVIGGSWSNVQAPEAAVFVAGDEEIRVQLHPSGTVWGRFHHAYPLPGM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10014856 [exp]	0	1
AT1G15780			unknown protein		Lus10015321 [exp]	12.0	0.8237
AT3G58750		CSY2	citrate synthase 2 (.1)		Lus10031385 [exp]	15.0	0.8108
AT1G30825		DIS2, ARPC2, AR...	DISTORTED TRICHOMES 2, ACTIN-R...		Lus10002867 [exp]	29.2	0.7813
AT3G16340		ABCG29, ATPDR1,...	ATP-binding cassette G29, plei...		Lus10013123 [exp]	42.2	0.7167
AT3G14280			unknown protein		Lus10003937 [exp]	42.6	0.7990
AT4G20140		GSO1	GASSHO1, Leucine-rich repeat t...		Lus10033519 [exp]	46.8	0.7477
AT4G35160			O-methyltransferase family pro...		Lus10023987 [exp]	50.6	0.7970
AT4G14590		EMB2739	embryo defective 2739 (.1)		Lus10032903 [exp]	57.8	0.7253
AT5G60660		PIP2F, PIP2;4	plasma membrane intrinsic prot...		Lus10015083 [exp]	62.5	0.7547
AT5G28740			Tetratricopeptide repeat (TPR)...		Lus10003866 [exp]	64.2	0.7148

Compare expression of checked genes

Lus10014856 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.