Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G27330 84 / 1e-20 zinc finger (C3HC4-type RING finger) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022324 [exp] 107 / 3e-29 AT3G27330 251 / 4e-75 zinc finger (C3HC4-type RING finger) family protein (.1) Lus10032119 [exp] 88 / 4e-22 AT3G27330 251 / 1e-75 zinc finger (C3HC4-type RING finger) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G336832 [exp] 91 / 4e-23 AT3G27330 235 / 2e-69 zinc finger (C3HC4-type RING finger) family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10014874 pacid=23142397 polypeptide=Lus10014874 locus=Lus10014874.g ID=Lus10014874.BGIv1.0 annot-version=v1.0 ATGGTGTACTTCCTTGCTTGGATATGTTCAAATGGTGTACTTCCTTGCTTGGATAAGCTTAGAGAAGAGCTTTCTTGCACTCCCCATGTGTCGGGACTAA CACCTAGTACCACATCTTGTGGACACAGCAATGGGAGATCATGCACTGTGAACACAGTTCTTTGGAACACAATACAGCTTCTATTTCCAAAAGAAGTGGA AGCAAGGAAGGCATCACCTGGGACACTGAACAACTGA
AA sequence Show only first row Show all	>Lus10014874 pacid=23142397 polypeptide=Lus10014874 locus=Lus10014874.g ID=Lus10014874.BGIv1.0 annot-version=v1.0 MVYFLAWICSNGVLPCLDKLREELSCTPHVSGLTPSTTSCGHSNGRSCTVNTVLWNTIQLLFPKEVEARKASPGTLNN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G27330			zinc finger (C3HC4-type RING f...		Lus10014874 [exp]	0	1
AT1G79460		ATKS1, ATKS, GA...	GA REQUIRING 2, ARABIDOPSIS TH...		Lus10029036 [exp]	12.5	0.8257
AT3G54750			unknown protein		Lus10012287 [exp]	20.2	0.7974
					Lus10004923 [exp]	22.8	0.7653
					Lus10033923 [exp]	30.9	0.7638
AT5G63135			unknown protein		Lus10019491 [exp]	37.9	0.7516
AT4G03220			Protein with RNI-like/FBD-like...		Lus10018509 [exp]	41.9	0.6212
					Lus10017831 [exp]	60.0	0.6928
AT5G47570			unknown protein		Lus10008504 [exp]	74.6	0.7106
AT3G61650		TUBG1	gamma-tubulin (.1)		Lus10010985 [exp]	88.6	0.6903
AT5G11280			unknown protein		Lus10026797 [exp]	92.5	0.7352

Compare expression of checked genes

Lus10014874 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.