Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G27670 70 / 1e-15 HSP21 heat shock protein 21 (.1) AT1G52560 57 / 9e-11 HSP20-like chaperones superfamily protein (.1.2) AT2G29500 45 / 2e-06 HSP20-like chaperones superfamily protein (.1) AT1G53540 43 / 7e-06 HSP20-like chaperones superfamily protein (.1) AT1G07400 43 / 7e-06 HSP20-like chaperones superfamily protein (.1) AT1G59860 42 / 1e-05 HSP20-like chaperones superfamily protein (.1) AT3G46230 42 / 2e-05 ATHSP17.4 ARABIDOPSIS THALIANA HEAT SHOCK PROTEIN 17.4, heat shock protein 17.4 (.1) AT5G59720 41 / 4e-05 HSP18.2 HSP18.1CI heat shock protein 18.2 (.1) AT5G37670 39 / 0.0001 HSP15.7CI HSP20-like chaperones superfamily protein (.1) AT4G10250 40 / 0.0002 ATHSP22.0 HSP20-like chaperones superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022322 [exp] 122 / 4e-36 AT4G27670 85 / 3e-20 heat shock protein 21 (.1) Lus10011385 [exp] 77 / 3e-18 AT4G27670 133 / 9e-39 heat shock protein 21 (.1) Lus10006444 [exp] 76 / 1e-17 AT4G27670 135 / 1e-39 heat shock protein 21 (.1) Lus10024225 [exp] 52 / 6e-09 AT1G52560 197 / 4e-63 HSP20-like chaperones superfamily protein (.1.2) Lus10023653 [exp] 51 / 2e-08 AT1G52560 210 / 5e-68 HSP20-like chaperones superfamily protein (.1.2) Lus10016456 [exp] 42 / 1e-05 AT1G07400 213 / 8e-72 HSP20-like chaperones superfamily protein (.1) Lus10016457 [exp] 42 / 1e-05 AT1G07400 216 / 4e-73 HSP20-like chaperones superfamily protein (.1) Lus10016458 [exp] 42 / 2e-05 AT2G29500 214 / 3e-72 HSP20-like chaperones superfamily protein (.1) Lus10009085 [exp] 42 / 3e-05 AT1G53540 232 / 2e-79 HSP20-like chaperones superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G053400 [exp] 86 / 2e-21 AT4G27670 141 / 2e-41 heat shock protein 21 (.1) Potri.001G192600 [exp] 59 / 3e-11 AT1G52560 191 / 8e-61 HSP20-like chaperones superfamily protein (.1.2) Potri.012G022400 [exp] 52 / 9e-09 AT4G27670 221 / 7e-73 heat shock protein 21 (.1) Potri.009G039200 [exp] 42 / 2e-05 AT1G07400 201 / 3e-67 HSP20-like chaperones superfamily protein (.1) Potri.010G175200 [exp] 42 / 3e-05 AT1G53540 107 / 5e-30 HSP20-like chaperones superfamily protein (.1) Potri.001G238700 [exp] 40 / 7e-05 AT1G53540 195 / 8e-65 HSP20-like chaperones superfamily protein (.1) Potri.004G187450 [exp] 40 / 0.0001 AT2G29500 221 / 5e-75 HSP20-like chaperones superfamily protein (.1) Potri.009G148000 [exp] 40 / 0.0001 AT2G29500 190 / 7e-63 HSP20-like chaperones superfamily protein (.1) Potri.010G195700 [exp] 39 / 0.0002 AT5G59720 190 / 1e-62 heat shock protein 18.2 (.1) Potri.004G187400 [exp] 39 / 0.0002 AT1G07400 193 / 7e-64 HSP20-like chaperones superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0190 [flax] [poplar] HSP20 PF00011 [flax] [poplar] HSP20 Hsp20/alpha crystallin family
Representative CDS sequence Show only first row Show all	>Lus10014876 pacid=23142401 polypeptide=Lus10014876 locus=Lus10014876.g ID=Lus10014876.BGIv1.0 annot-version=v1.0 ATGGCAGGAGAGCCTCTCCCAATGCTGTCAAGGTCTTTGCTGAGAAAAGAGACAACCTTGACAACTTGCAGAGAGTGGGCAACCAGCACCAACAACAGCA ATCCCAATTTAAAACATTTCAGCAGTAGGCATCCACTGGGAGAGAAGGCTCTCAGCACTGATAATAACAACGAACACGGCTCAGCAAATGATGGAGGAGT TGCTGCTGCTGCTGCTGATGAAGGCTGGTCGAGTAAGAGCTATGGCAAATACAGTTTCCGAATTGCATTACCAGACAACATCGAGTTTGAGAAGATCAAG GCAGAGGTGAAAGATGGTGTCTTGTATGTCACCATTCCTAAAGCAACCACCACCCGCAAAGTCATAGACATTGATATCGAATGA
AA sequence Show only first row Show all	>Lus10014876 pacid=23142401 polypeptide=Lus10014876 locus=Lus10014876.g ID=Lus10014876.BGIv1.0 annot-version=v1.0 MAGEPLPMLSRSLLRKETTLTTCREWATSTNNSNPNLKHFSSRHPLGEKALSTDNNNEHGSANDGGVAAAAADEGWSSKSYGKYSFRIALPDNIEFEKIK AEVKDGVLYVTIPKATTTRKVIDIDIE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G27670		HSP21	heat shock protein 21 (.1)		Lus10014876 [exp]	0	1
AT1G52560			HSP20-like chaperones superfam...		Lus10023653 [exp]	1.7	0.9579
AT4G27670		HSP21	heat shock protein 21 (.1)		Lus10006444 [exp]	2.0	0.9662
AT2G26150	HSF	ATHSFA2	heat shock transcription facto...		Lus10039134 [exp]	2.8	0.9426
AT1G52560			HSP20-like chaperones superfam...		Lus10024225 [exp]	3.0	0.9746
AT2G40340	AP2_ERF	AtERF48, DREB2C	Integrase-type DNA-binding sup...		Lus10023633 [exp]	8.5	0.8541
AT2G18370			Bifunctional inhibitor/lipid-t...		Lus10001432 [exp]	9.2	0.8292
AT3G10020			unknown protein		Lus10002842 [exp]	9.2	0.9071
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10014062 [exp]	10.2	0.9426
AT3G02230		ATRGP1, RGP1	ARABIDOPSIS THALIANA REVERSIBL...		Lus10034376 [exp]	10.4	0.8839
AT5G56990			unknown protein		Lus10029528 [exp]	11.2	0.9426

Compare expression of checked genes

Lus10014876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.