Lus10014884 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G14360 137 / 2e-41 Ubiquitin-like superfamily protein (.1)
AT5G40630 127 / 1e-37 Ubiquitin-like superfamily protein (.1)
AT5G62100 74 / 2e-16 ATBAG2 BCL-2-associated athanogene 2 (.1.2.3)
AT5G07220 74 / 9e-16 ATBAG3 BCL-2-associated athanogene 3 (.1)
AT3G51780 71 / 8e-15 ATBAG4 BCL-2-associated athanogene 4 (.1)
AT5G52060 71 / 1e-14 ATBAG1 BCL-2-associated athanogene 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022315 272 / 6e-94 AT5G14360 158 / 2e-49 Ubiquitin-like superfamily protein (.1)
Lus10032107 132 / 1e-38 AT5G40630 136 / 4e-41 Ubiquitin-like superfamily protein (.1)
Lus10005051 88 / 2e-20 AT3G51780 221 / 1e-69 BCL-2-associated athanogene 4 (.1)
Lus10027420 86 / 8e-20 AT5G52060 349 / 6e-120 BCL-2-associated athanogene 1 (.1)
Lus10027822 85 / 8e-20 AT3G51780 221 / 4e-71 BCL-2-associated athanogene 4 (.1)
Lus10023279 82 / 3e-19 AT5G07220 196 / 4e-62 BCL-2-associated athanogene 3 (.1)
Lus10038882 78 / 3e-17 AT5G52060 327 / 1e-111 BCL-2-associated athanogene 1 (.1)
Lus10015004 78 / 4e-17 AT5G52060 333 / 4e-114 BCL-2-associated athanogene 1 (.1)
Lus10005772 67 / 5e-13 AT5G52060 304 / 2e-102 BCL-2-associated athanogene 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G339100 150 / 3e-46 AT5G14360 166 / 6e-53 Ubiquitin-like superfamily protein (.1)
Potri.009G074300 103 / 3e-27 AT3G51780 196 / 4e-62 BCL-2-associated athanogene 4 (.1)
Potri.001G279500 101 / 4e-26 AT3G51780 210 / 2e-67 BCL-2-associated athanogene 4 (.1)
Potri.015G135500 84 / 4e-19 AT5G52060 303 / 2e-101 BCL-2-associated athanogene 1 (.1)
Potri.012G133400 80 / 1e-17 AT5G52060 305 / 2e-102 BCL-2-associated athanogene 1 (.1)
Potri.003G121500 77 / 5e-17 AT5G52060 243 / 1e-78 BCL-2-associated athanogene 1 (.1)
Potri.001G358200 74 / 7e-16 AT5G07220 207 / 9e-66 BCL-2-associated athanogene 3 (.1)
Potri.001G110300 72 / 5e-15 AT5G52060 239 / 2e-76 BCL-2-associated athanogene 1 (.1)
Potri.016G121200 62 / 8e-12 AT3G51780 218 / 1e-70 BCL-2-associated athanogene 4 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00240 ubiquitin Ubiquitin family
Representative CDS sequence
>Lus10014884 pacid=23142409 polypeptide=Lus10014884 locus=Lus10014884.g ID=Lus10014884.BGIv1.0 annot-version=v1.0
ATGAAGATGTTGAAGTTGAAGTACAAGAAACTGTGCAGAGGGATCAGCTCCAAGCTAATTGGTGGAAGCAAGAAGACTAGTACTGATCATCAAAAAGGGT
CACCCAGATCATCATTATCACCATCATCTTCTTCCTTGTCATCATCATTTTCCTCTTCATCGTCCAATAATGGTGACATCAAATGGGAGGTTAGGCCAGG
TGGTATGCTGGTCCAAAAGAGGCAACAAAATGGTGATTCCACTAGCAGCACCACCAGTACTGAAGAGTTGCTCACACTCAGGGTTTCAACTGTTTCCCAA
TTGCATCATATCTCCATTGAAGCTACTTCCACCTTTGGGGAACTGAAGATGATGTTGGCATTGGTGACAAACTTGGAGCCAAAGGAGCAGAGGGTATTGT
TCAAAGGGAAAGAAAGGGAAGACTGTGAGTATCTACACATGGTTGGGGTCAGAGACAAAGACAAAGTGCTGCTTTTGGAAGATCCAGCAATCAAGGATAA
GAAGCTCAGACTCCAACAGGCCACTTTGATCTCCTCTGTTCATCATCTCCACCACCAACATCCACTTGCTAATTATTGCAGCATTACTGTATAG
AA sequence
>Lus10014884 pacid=23142409 polypeptide=Lus10014884 locus=Lus10014884.g ID=Lus10014884.BGIv1.0 annot-version=v1.0
MKMLKLKYKKLCRGISSKLIGGSKKTSTDHQKGSPRSSLSPSSSSLSSSFSSSSSNNGDIKWEVRPGGMLVQKRQQNGDSTSSTTSTEELLTLRVSTVSQ
LHHISIEATSTFGELKMMLALVTNLEPKEQRVLFKGKEREDCEYLHMVGVRDKDKVLLLEDPAIKDKKLRLQQATLISSVHHLHHQHPLANYCSITV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G14360 Ubiquitin-like superfamily pro... Lus10014884 0 1
AT5G53980 HD ATHB52 homeobox protein 52 (.1) Lus10003492 1.7 0.9185
Lus10030905 2.6 0.9222
AT2G42760 unknown protein Lus10005429 3.5 0.9186
AT1G10740 alpha/beta-Hydrolases superfam... Lus10030904 5.7 0.9135
AT1G75540 CO LHUS, AtBBX21, ... long hypocotyl under shade, B-... Lus10033184 6.0 0.8853
AT1G73830 bHLH bHLH050, BEE3 BR enhanced expression 3 (.1.2... Lus10038939 6.3 0.8863
AT4G22320 unknown protein Lus10021308 8.8 0.8252
AT1G09570 FHY2, HY8, FRE1... ELONGATED HYPOCOTYL 8, FAR RED... Lus10007594 11.0 0.9007
AT4G22320 unknown protein Lus10016987 11.2 0.8003
AT5G08350 GRAM domain-containing protein... Lus10017373 12.0 0.8674

Lus10014884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.