Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G23030 78 / 8e-19 PUB11 ARM repeat superfamily protein (.1) AT1G71020 77 / 2e-18 ARM repeat superfamily protein (.1.2) AT2G28830 73 / 4e-17 AtPUB12 PLANT U-BOX 12 (.1) AT3G46510 72 / 1e-16 ATPUB13 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) AT3G54850 72 / 1e-16 ATPUB14 plant U-box 14 (.1) AT5G58680 43 / 1e-06 ARM repeat superfamily protein (.1) AT3G01400 42 / 4e-06 ARM repeat superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043471 [exp] 106 / 1e-28 AT1G71020 682 / 0.0 ARM repeat superfamily protein (.1.2) Lus10034113 [exp] 105 / 1e-28 AT3G59770 1913 / 0.0 ARABIDOPSIS THALIANA SUPPRESSOR OF ACTIN 9, sacI homology domain-containing protein / WW domain-containing protein (.1.2.3) Lus10038699 [exp] 75 / 1e-17 AT3G54850 599 / 0.0 plant U-box 14 (.1) Lus10037970 [exp] 75 / 1e-17 AT3G54850 803 / 0.0 plant U-box 14 (.1) Lus10040834 [exp] 69 / 1e-15 AT3G46510 879 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) Lus10016565 [exp] 68 / 2e-15 AT3G46510 884 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) Lus10007738 [exp] 47 / 1e-07 AT3G01400 555 / 0.0 ARM repeat superfamily protein (.1) Lus10012260 [exp] 43 / 3e-06 AT5G42340 695 / 0.0 Plant U-Box 15 (.1) Lus10019308 [exp] 41 / 1e-05 AT2G23140 911 / 0.0 RING/U-box superfamily protein with ARM repeat domain (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G113900 [exp] 96 / 3e-25 AT1G23030 732 / 0.0 ARM repeat superfamily protein (.1) Potri.008G128600 [exp] 90 / 5e-23 AT1G23030 697 / 0.0 ARM repeat superfamily protein (.1) Potri.009G029600 [exp] 74 / 3e-17 AT3G46510 935 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) Potri.010G226500 [exp] 73 / 6e-17 AT3G54850 806 / 0.0 plant U-box 14 (.1) Potri.001G238500 [exp] 72 / 1e-16 AT3G46510 912 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 13, plant U-box 13 (.1) Potri.008G035700 [exp] 70 / 5e-16 AT3G54850 821 / 0.0 plant U-box 14 (.1) Potri.009G165900 [exp] 54 / 3e-10 AT5G42340 671 / 0.0 Plant U-Box 15 (.1) Potri.002G009900 [exp] 49 / 1e-08 AT5G42340 763 / 0.0 Plant U-Box 15 (.1) Potri.002G118800 [exp] 45 / 3e-07 AT3G01400 521 / 0.0 ARM repeat superfamily protein (.1) Potri.014G016400 [exp] 45 / 3e-07 AT3G01400 557 / 0.0 ARM repeat superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF00514 [flax] [poplar] Arm Armadillo/beta-catenin-like repeat
Representative CDS sequence Show only first row Show all	>Lus10014900 pacid=23142442 polypeptide=Lus10014900 locus=Lus10014900.g ID=Lus10014900.BGIv1.0 annot-version=v1.0 ATGTACCAAGGGAACAAAGGGAGAGTGGTAAGAGTAGGGATAATCCCTGCATTGCTGAGAATGCTAACCGATTCCAAGAGTGGGATGGTGGACGAAGCTC TGACGATCCTTTCGGTGCTGTCAAGTAATCTAGAAGCGAAAGGGGCGGTCGTGAAGGCAAGTATGATTCCGGTACTGATAGACGCGACTTAA
AA sequence Show only first row Show all	>Lus10014900 pacid=23142442 polypeptide=Lus10014900 locus=Lus10014900.g ID=Lus10014900.BGIv1.0 annot-version=v1.0 MYQGNKGRVVRVGIIPALLRMLTDSKSGMVDEALTILSVLSSNLEAKGAVVKASMIPVLIDAT

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G23030		PUB11	ARM repeat superfamily protein...		Lus10014900 [exp]	0	1
AT1G29430			SAUR-like auxin-responsive pro...		Lus10007067 [exp]	1.0	0.9503
AT5G53820			Late embryogenesis abundant pr...		Lus10007566 [exp]	5.3	0.9082
					Lus10035428 [exp]	6.2	0.7893
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	6.5	0.9082
					Lus10033071 [exp]	7.5	0.9082
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10014436 [exp]	8.4	0.9082
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Lus10015428 [exp]	9.2	0.9082
					Lus10003695 [exp]	9.9	0.9082
					Lus10003774 [exp]	10.6	0.9082
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10005596 [exp]	11.2	0.9082

Compare expression of checked genes

Lus10014900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.