Lus10014916 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G24820 619 / 0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
AT3G61140 84 / 1e-17 EMB78, CSN1, COP11, ATFUS6, FUS6, ATSK31 EMBRYO DEFECTIVE 78, COP9 SIGNALOSOME SUBUNIT 1, CONSTITUTIVE PHOTOMORPHOGENIC 11, SHAGGY-LIKE KINASE 31, ARABIDOPSIS THALIANA FUSCA 6, 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027348 684 / 0 AT4G24820 698 / 0.0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
Lus10014789 669 / 0 AT4G24820 691 / 0.0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
Lus10017932 639 / 0 AT4G24820 660 / 0.0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G090900 650 / 0 AT4G24820 671 / 0.0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
Potri.012G093500 647 / 0 AT4G24820 680 / 0.0 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.1), 26S proteasome, regulatory subunit Rpn7;Proteasome component (PCI) domain (.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF10602 RPN7 26S proteasome subunit RPN7
CL0123 HTH PF01399 PCI PCI domain
Representative CDS sequence
>Lus10014916 pacid=23152799 polypeptide=Lus10014916 locus=Lus10014916.g ID=Lus10014916.BGIv1.0 annot-version=v1.0
ATGGATTTCCCAGAGGGAGCTCAACAACCGCATCTGGTTCTTGCCAACAAGCTCTTCCTCCTGACCCACCCAGATGTCCAGGACATCGAGAAGGTCCGCC
TCAAGGAGGAGGTTTTGGATACCATCAAAACCCATGATGCAGAAGAAAACTTGGGAGAAAGTGAAGTTAGAGAAGCTCATCTTGCAAAATCCTTGTTCTA
CATTCGTATTGGTGACAAGGAGAAAGCATTGGAACAACTTAAAGTGACGGAAAGCAAAACGGTTGCAGTTGGACAAAAGATGGACTTGGTATTCTACACC
TTGCAACTCGGTTTCTTCTACATGGATTTCGATCTCATCTCCAAGAGCATTGACAAGGCAAAGAACTTGTTCGAAGAGGGAGGTGACTGGGAGAGGAAAA
ACCGTCTCAAAGTGTATGAAGGCCTGTACTGCATGTCTACTCGCAATTTCAAGAAGGCTGCAGATTTGTTTCTAGATTCTATCTCGACCTTCACCACATA
TGAGATATTCCCCTACGACACTTTCATATTCTACACCGTTCTGACAAGCATCATATCCTTGGATAGAGTGTCTCTTAAGCAGAAGGTGGTGGATGCGCCT
GAAATCCTGGCTGTTATAGGAAAGATCCCACATCTCTCGGAGTTTCTTAACTCGCTCTACGATTGCCAGTACAAGTCTTTCTTCTCTGCTTTTGCTGGCT
TGACCGAGCAAGTAAAGCTAGACCGGTACTTGCACCCGCATTTCCGGTACTACATGAGGGAGGTGAGAACGGTGGTATACTCCCAGTTCCTGGAGTCCTA
CAAGAGCGTAACAATCGAGGCAATGGCGAAGGCATTCGGCGTGACAGTGGATTTCATCGATTTGGAGTTGTCAAGGTTCATTGCAGCGGGGAAACTACAC
TGCAAGATCGACAAAGTAGCTGGGGTTCTTGAAACGAACCGTCCTGATGCGAAGAATGCTCTTTACCAGGCAACGATCAAGCAAGGGGACTTCTTGCTGA
ACAGGATTCAGAAGCTGTCCCGGGTGATCGACTTGTAG
AA sequence
>Lus10014916 pacid=23152799 polypeptide=Lus10014916 locus=Lus10014916.g ID=Lus10014916.BGIv1.0 annot-version=v1.0
MDFPEGAQQPHLVLANKLFLLTHPDVQDIEKVRLKEEVLDTIKTHDAEENLGESEVREAHLAKSLFYIRIGDKEKALEQLKVTESKTVAVGQKMDLVFYT
LQLGFFYMDFDLISKSIDKAKNLFEEGGDWERKNRLKVYEGLYCMSTRNFKKAADLFLDSISTFTTYEIFPYDTFIFYTVLTSIISLDRVSLKQKVVDAP
EILAVIGKIPHLSEFLNSLYDCQYKSFFSAFAGLTEQVKLDRYLHPHFRYYMREVRTVVYSQFLESYKSVTIEAMAKAFGVTVDFIDLELSRFIAAGKLH
CKIDKVAGVLETNRPDAKNALYQATIKQGDFLLNRIQKLSRVIDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G24820 26S proteasome, regulatory sub... Lus10014916 0 1
AT3G22110 PAC1 20S proteasome alpha subunit C... Lus10004235 1.0 0.9453
AT1G64520 RPN12A regulatory particle non-ATPase... Lus10032420 2.0 0.9396
AT2G27020 PAG1 20S proteasome alpha subunit G... Lus10037416 2.8 0.9212
AT1G56450 PBG1 20S proteasome beta subunit G1... Lus10036124 4.2 0.9169
AT4G18040 LSP1, CUM1, AT.... eukaryotic translation Initiat... Lus10005410 6.3 0.9112
AT5G05670 signal recognition particle bi... Lus10029130 8.5 0.8892
AT5G22330 ATTIP49A, RIN1 RESISTANCE TO PSEUDOMONAS SYRI... Lus10040479 8.8 0.9056
AT3G49100 Signal recognition particle, S... Lus10018775 9.2 0.9030
AT1G60170 EMB1220 embryo defective 1220, pre-mRN... Lus10012997 10.6 0.9139
AT1G04850 ubiquitin-associated (UBA)/TS-... Lus10037827 11.2 0.9148

Lus10014916 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.